(data stored in ACNUC1104 zone)

EMBL: CP000959.PE316

CP000959.PE316       Location/Qualifiers
FT   CDS_pept        376387..377202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3504"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2063 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92657"
FT                   /db_xref="GOA:B1K2L2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L2"
FT                   /protein_id="ACA92657.1"
FT                   /translation="MSHAATPSATPPATADRRLHVPDWRGFVLPLAALACWWALASAHL
FT                   MKSGLFVSPADVLHTAWAQATSGALGRALSASLAREACGFAIGATGGLLLGAVLGLSRV
FT                   AARMVGPSFDTFKQISLFAWIPLISVWFGLGDVAKVVFLSLAALLPVAAHTCDGIHAVP
FT                   RTYVDVARALRYSRLQLIRYVILPAALPSIFTGLYLGLIYSWLATLGAEYLLVAGSGIG
FT                   NTLIDGSEQFRMDLVLFGIIVVGVTGWALNATARAIERKVLARRGDLTR"
     gtgtcgcacg ccgccacacc gtcagccaca ccgcccgcca ccgccgaccg ccgcctgcat        60
     gtacccgact ggcgcggctt cgtgctgccg ctcgccgcac ttgcgtgctg gtgggccctc       120
     gcttccgcgc acctcatgaa aagcgggctg ttcgtcagcc ccgccgacgt gctgcacacc       180
     gcgtgggcgc aggccacgag cggcgcgctc ggccgtgcct tgtcggcatc gctcgcgcgc       240
     gaagcgtgcg ggttcgcgat cggcgcgacg ggcgggctgt tgctcggcgc cgtgctcggg       300
     ctgtcgcgcg tcgccgcgcg gatggtcggc ccgagcttcg acacgttcaa gcagatctcg       360
     ctgttcgcgt ggattccact gatttccgta tggttcgggc tcggcgacgt cgcgaaggtc       420
     gtgttcctgt cgctcgccgc gctgctgccg gtcgccgccc atacctgcga cggcattcac       480
     gcggtgccgc gcacgtacgt cgacgtcgcc cgcgcgctgc gctattcgcg gctccagttg       540
     atccgctacg tgatcctgcc ggccgcgctg ccgtcgatct tcaccggcct gtatctcggc       600
     ctgatctatt cgtggctcgc gacgctcggc gccgaatacc tgctcgtcgc cggcagcggg       660
     atcggcaaca cgctgatcga cggcagcgag cagttccgga tggatctcgt gctgttcggg       720
     atcatcgtcg tcggcgtgac cggctgggca ctgaacgcga ccgcgcgggc gatcgagcgc       780
     aaggtgctgg cccggcgcgg cgacctgacg cgctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page