(data stored in ACNUC1104 zone)

EMBL: CP000959.PE32

CP000959.PE32        Location/Qualifiers
FT   CDS_pept        complement(36479..36961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3217"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bam:Bamb_3718 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92373"
FT                   /db_xref="GOA:B1K893"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K893"
FT                   /protein_id="ACA92373.1"
FT                   /translation="MATRERTPKTLDNQDRKILGALQKNARLSNAELAEQIGMSTTACW
FT                   NRTRQLELDGYIDGYVALVNQRKLGYADIVILEVTLDRHEDDALARFGAELAALPEVLE
FT                   AYLVSGEYDYWIKVAVDGTAGYERFLREKLYRISSIRHSRSMFALRCMKDVPSIQV"
     atggctaccc gcgaacgcac gcccaaaacg ctcgacaatc aagaccgcaa gatcctcggt        60
     gcattgcaga aaaatgcgcg cctgtcgaac gccgaactgg ccgaacagat cggcatgtcg       120
     accaccgcct gctggaaccg cacgcggcaa ctcgaactcg acggctacat cgacggctac       180
     gtcgcgctgg tcaaccagcg caagctcggc tacgcggaca tcgtgatcct cgaagtcacg       240
     ctcgatcgcc atgaagacga cgcactggcg cgcttcggcg ccgaactggc ggcgctgccg       300
     gaggtgctcg aggcgtatct ggtgtcgggc gagtacgact actggatcaa ggtcgcggtg       360
     gacggcacgg cgggctacga acgcttcctg cgcgaaaagc tgtaccggat ttcgagcatc       420
     cgccacagcc gttcgatgtt cgcgctgcgg tgcatgaagg atgtgccttc gattcaggtg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page