(data stored in ACNUC1104 zone)

EMBL: CP000959.PE320

CP000959.PE320       Location/Qualifiers
FT   CDS_pept        complement(380341..382002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3508"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bur:Bcep18194_B2067 ABC peptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92661"
FT                   /db_xref="GOA:B1K2L6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L6"
FT                   /protein_id="ACA92661.1"
FT                   /translation="MKNPFVSSAARQSRGVSPAGAALRCIAASLLLAGAATHAFAAPTG
FT                   KTLVYCTEGSPAGFDPGQHTTSTDFDASTYPVYNGLVQFKRGTLDLEPALATSWDVSPD
FT                   QRTITFHLRRGVKFQTTAWFKPTRPFQADDVVFTFRRMLDPDDPFRKAYPVSFPYFSDL
FT                   GFDHNIERIEKVDDYTVRFVLKSPDVVFVRNLAMAFASVLSAEYAGQLAARHRESDINQ
FT                   FPVGTGPFVLRTYQKDALIRYDANPDYWKPDDVKLSRLVFAITPDPAARLQKLVAGECQ
FT                   VSAFPRPADLETVRRDPKLTLFSGTGFNVGFVAYNTQHPPLDRVDVRRALDIAIDKTAI
FT                   IKTVFNGDATVATNPMPPAQWSYNPRLKDAPRDPAVAKALLAQAGFPNGFDLTLWAMPV
FT                   QRPYNPNAQLMAQLIQQDWAKIGVRAKIVSYEWGEYNRRAKHDGQHDAILYGWSGDNGD
FT                   PDNWLGTLLGCEAVHGSNLAKWCNKDFEQLVTAARSNGDVAKRTALYEQAQVVFKDQVP
FT                   FTPIATSIVSLPISRRVHGLTFSPLGGHRFDGVWLD"
     atgaagaatc ctttcgtttc gtcagccgcg cgccaatcgc gcggcgtatc gcccgccggc        60
     gccgcgcttc gctgcatcgc cgcgtcgttg ctgctggccg gcgccgcgac gcacgcgttt       120
     gcggcgccca cgggcaagac gctcgtgtac tgcaccgaag gcagcccggc cggcttcgat       180
     cccggccagc acacgacgag caccgatttc gatgcgagca cgtacccggt ctacaacggg       240
     ctcgtgcaat tcaagcgcgg cacgctcgac ctcgaaccgg cgctcgcgac gagctgggac       300
     gtgtcgcccg accagcgcac gatcacgttc cacctgcggc gcggcgtgaa attccagacg       360
     accgcatggt tcaagccgac gcggccgttc caggccgacg acgtcgtgtt cacgttccgc       420
     cggatgctcg acccggacga tccgttccgc aaggcgtatc cggtcagctt cccgtatttc       480
     agcgatctcg gcttcgacca caacatcgaa cgcatcgaga aggtcgacga ctatacggtg       540
     cgcttcgtgc tgaagtcgcc cgacgtcgtg ttcgtgcgca atctcgcgat ggcgttcgcg       600
     tcggtgctgt cggccgaata tgcggggcag ctcgccgcgc gccatcgcga gtcggacatc       660
     aaccagttcc cggtcggcac ggggccgttc gtgttgcgta cgtaccagaa ggatgcgctg       720
     atccgctacg acgcgaatcc cgactactgg aagccggacg acgtgaagct gtcccgcctc       780
     gtgttcgcga tcacgcccga tccggccgcg cggctgcaga agctcgtggc cggcgagtgc       840
     caggtatcgg cgtttccgcg gccggccgat ctcgagacgg tgcggcgcga cccgaagctg       900
     acgctgtttt ccgggacggg tttcaacgtc ggcttcgtcg cgtacaacac gcagcatccg       960
     ccgctcgatc gcgtcgacgt gcggcgcgcg ctcgacatcg cgatcgacaa gacggcgatc      1020
     atcaagaccg tgttcaacgg cgacgcgacg gtcgcgacga acccgatgcc gcccgcgcaa      1080
     tggtcgtaca acccgcggct gaaggatgcg ccgcgcgatc cggccgtcgc gaaggcgctg      1140
     ctcgcgcagg ccggcttccc gaacggtttc gacctgacgc tgtgggcgat gcccgtgcag      1200
     cgcccgtaca acccgaacgc gcaactgatg gcgcaactga tccagcagga ctgggcgaag      1260
     atcggcgtgc gcgcgaagat cgtcagctac gaatggggcg agtacaaccg ccgcgcgaag      1320
     cacgacggcc agcacgacgc gatcctgtac ggctggtcgg gcgacaacgg cgaccccgac      1380
     aactggctcg gcacgctgct cggctgcgag gcggtgcacg gcagcaatct cgcgaagtgg      1440
     tgcaacaagg acttcgagca gctcgtgacc gccgcgcgtt cgaacgggga cgtcgcgaag      1500
     cgcacggcgc tgtacgagca ggcgcaggtg gtgttcaagg atcaggtgcc gttcacgccg      1560
     atcgcgacgt cgatcgtgtc gttgccgatc tccagacgcg tgcacgggct gacgttctcg      1620
     ccgctcggcg ggcaccggtt cgacggtgtg tggctcgatt ga                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page