(data stored in ACNUC1104 zone)

EMBL: CP000959.PE322

CP000959.PE322       Location/Qualifiers
FT   CDS_pept        382989..383981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3510"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   bur:Bcep18194_B2069 ABC transporter, substrate-binding
FT                   protein, aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92663"
FT                   /db_xref="GOA:B1K2L8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L8"
FT                   /protein_id="ACA92663.1"
FT                   /translation="MNDTPHADLETTPANPRRRQWLHGAAAGLAGLALGLLAAAPARAD
FT                   DSGTRLRIGFQKYGNFVVLKARGTLEKRLASQGVTVQWLEFPAGPQLLEGLNAGAIDVG
FT                   TVGETPPIFAQAAGVDFVYIGNEPPAPRGEAIVVLPDSPIRTLAQLRGKKVAFNKGSNV
FT                   HYLLVKALEHAGLTYADIQPIYLTPADARAAFVQRSVDAWVIWDPYLAAAERQLGARVV
FT                   ANGEGLVRNTQYYLAARKYAAAHPQVLRALLDEVDSVDRWARDHVPEVAAQLSPLVGLD
FT                   APTLEVALKRAGYGVQPITDATVAYQQSIADAFTTLKLIPGKLSVASAR"
     atgaacgaca caccgcacgc agaccttgaa acgaccccgg cgaacccgcg ccgccgccag        60
     tggctgcacg gcgcggccgc cgggctggcc gggctcgcgc tcggactgct cgcggccgca       120
     ccggcccggg ccgacgacag cggcacgcgg ctgcgcatcg gcttccagaa atacggcaac       180
     ttcgtcgtgc tcaaggcgcg cggcacgctc gagaagcgtc tggcgagcca gggcgtcacc       240
     gtgcaatggc tcgaattccc ggccggcccg caactgctcg aagggctgaa cgccggcgcg       300
     atcgacgtcg gcacggtcgg cgaaaccccg ccgatcttcg cgcaggccgc cggcgtcgat       360
     ttcgtctaca tcggcaacga gccgcccgcg cctcggggcg aggcaatcgt cgtgctgccc       420
     gattcgccga tccgcaccct cgcgcaactg cgcggcaaga aggtcgcgtt caacaagggc       480
     tcgaacgtcc attacctgct ggtgaaggcg ctcgagcatg cgggcctcac gtatgccgac       540
     atccagccga tctatctgac gccggccgac gcgcgcgccg cgttcgtgca gcgcagcgtc       600
     gatgcgtggg tgatctggga tccgtatctg gccgccgccg aacggcagct cggcgcgcgc       660
     gtggtcgcga atggcgaagg gctcgtgcgc aacacgcagt actacctcgc cgcacgcaag       720
     tacgcggccg cccacccgca ggtgctgcgc gcgctgctcg acgaagtcga ctcggtcgat       780
     cgctgggcgc gcgatcacgt gcccgaggtg gccgcgcaac tgtcgccgct cgttggcctc       840
     gacgcgccga cgctcgaagt cgcgctcaag cgcgccggct acggcgtgca gccgatcacc       900
     gacgcgacgg ttgcgtacca gcagagcatc gccgacgcgt tcaccacgct gaagctgatt       960
     ccgggcaagc tgtcggtcgc cagcgcacgc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page