(data stored in ACNUC1104 zone)

EMBL: CP000959.PE323

CP000959.PE323       Location/Qualifiers
FT   CDS_pept        complement(383986..384570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3511"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   bur:Bcep18194_B2070 protein of unknown function DUF1089"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92664"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L9"
FT                   /protein_id="ACA92664.1"
FT                   /translation="MTQRNEARRTHCVAWQIVQTWQAAEWCRLDASQTGVALSGAVAGA
FT                   IDGTPFRIDYAIACGTDWLTRSARVTHWTGTAPPRQWDIACNAGQWTIDGVDAPMLAGA
FT                   TDIDLGFSPSTNTLPIRRLALAVGESAAIRTAWLRFPDFDIVRGEQRYTRTAPHVYRYE
FT                   SGTYAADIGIDDAGLVTDYDEWRRVGAASAS"
     atgacgcaac gcaatgaagc ccgacgcacg cactgcgtcg cctggcagat cgtgcagacg        60
     tggcaggcgg ccgaatggtg ccggctcgac gcgtcgcaaa cgggcgtcgc gctgtcggga       120
     gcggtcgcgg gtgcgatcga cggcacgccg tttcgcatcg attacgcgat cgcatgcggg       180
     accgactggc tcacgcgctc ggcgcgcgtg acgcattgga ccggcacggc gccgccacgg       240
     caatgggaca tcgcgtgcaa tgcagggcag tggacgatcg acggcgtcga tgcgccgatg       300
     ctcgcgggcg caaccgacat cgatctcggc ttcagtccgt cgaccaatac gctgccgatc       360
     cggcggctgg cgctcgccgt cggcgagtcg gccgcgatcc gcaccgcgtg gctgcgtttt       420
     cccgacttcg acatcgtgcg cggcgagcag cgctatacgc gcacggcgcc gcacgtctat       480
     cgctacgaga gcggcacgta tgcggccgac atcggaatcg acgacgcggg cctcgtcacc       540
     gactacgacg aatggcggcg cgtcggcgcg gcgtctgcgt cgtga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page