(data stored in ACNUC1104 zone)

EMBL: CP000959.PE324

CP000959.PE324       Location/Qualifiers
FT   CDS_pept        384768..385676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3512"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2071
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92665"
FT                   /db_xref="GOA:B1K2M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M0"
FT                   /protein_id="ACA92665.1"
FT                   /translation="MDLLATMRIYVRVVERGTMSGAARDLDMGQPAVSERIEKLEKHLG
FT                   TRLLMRSARTLACTEEGRIFYERSKALLEAAELAVASVSKTAHALDGTIRLAAPQCFGE
FT                   VVLPGVLMQIRTAYPKLHIDLVLNDDIVDPVTEGVDISIRVGQLGDGGFVAYALGAVGR
FT                   VLVAAPSYLDRHGPLDTKADLANHPFIRVKGVFANEQVPLRHDGGAVEYARIRTVMTAS
FT                   HWRPMFDTIAAGGGIGVVQHPACTDALAHGRLVRLLPHYDVPDFALNVLVHAQRPLPPR
FT                   VRAVVDLLKSELPPLLTQGQR"
     atggatttgt tggcgacgat gcgcatctac gtgagagtcg tggagcgcgg cacgatgtcc        60
     ggcgcggcgc gggatctcga catgggccaa ccggccgtca gcgagcgcat cgagaagctc       120
     gaaaagcatc tcggcacgcg gctgctgatg cgcagtgcac gcaccctcgc gtgcacggag       180
     gaaggccgga ttttctacga acgcagcaag gcgctgctcg aagcggccga actggccgtt       240
     gcgtcggtat cgaagacggc gcatgcgctc gacggcacga tccggctcgc ggcgccgcaa       300
     tgtttcggcg aggtcgtgct gccgggcgtg ctgatgcaga tccgcaccgc gtatccgaag       360
     ctgcacatcg acctcgtgct gaacgacgat atcgtcgatc cggtcaccga gggcgtcgac       420
     atttcgatcc gggtcggcca gctcggcgac ggcggattcg tcgcgtacgc actcggcgcg       480
     gtcggccgcg tgctcgtcgc cgcgccgtcg tatctcgacc ggcacggccc gctcgacacg       540
     aaggccgatc tcgcgaacca tccgttcatc cgcgtgaaag gcgtgttcgc gaacgaacag       600
     gtgccgctgc ggcacgacgg cggtgcggtc gaatacgcgc gcatccgcac cgtcatgacc       660
     gcgagccact ggcgcccgat gttcgacacg atcgcggcgg gcggcggcat cggcgtggtc       720
     cagcacccgg cttgcaccga tgcgctcgcg cacggccggc tcgtccgcct gctgccgcac       780
     tacgacgtcc ccgacttcgc gctcaacgtg ctggtacacg cgcagcggcc gctgccgccg       840
     cgcgtgcgag ccgtcgtcga tctgctgaaa agcgaactcc cgccgctgct gacgcaaggt       900
     cagcgctag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page