(data stored in ACNUC1104 zone)

EMBL: CP000959.PE326

CP000959.PE326       Location/Qualifiers
FT   CDS_pept        complement(387131..389431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3514"
FT                   /product="response regulator receiver protein"
FT                   /EC_number="4.1.1.18"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bur:Bcep18194_B2074 response regulator receiver domain
FT                   protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92667"
FT                   /db_xref="GOA:B1K2M2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M2"
FT                   /protein_id="ACA92667.1"
FT                   /translation="MNTSIGGIRRLGMRALLVDDEIAQETATGRAVRTLSAELAQRGVD
FT                   VLTATSADDAIVLIRSDPSIQCVLLDWDLGVDGHGPSEAVVDAIRHRNGSVPIFLLADR
FT                   SVASSVPAAVMGKVDDFVWLLEDTADFIGGRIHAAIERYRSTVLPPMFGALAKFSRVYE
FT                   YSWHTPGHTGGTGFLKSPVGRAFFEYFGESLFRSDLSISVGELGSLLDHSGPIGESERY
FT                   AARVFGAHRTYHVTNGSSTSNRIILMTSVSRDQIALCDRNCHKSAEHAMTMSGAIPTYL
FT                   VPTRNRYGIIGPIAPERLTQVAIREAIASNPLAAGLADRQPKHAIVTNSTYDGLCYNVT
FT                   RVEELLGASVDRLHFDEAWYGYARFNPIYRDRHAMHGDPRDHHKDRPTVFATQSTHKLL
FT                   TALSQASYIHVRDGRSPIPHGQFNETFMMHASTSPNYAIIASNDVAAAMMDGPGGAALT
FT                   RESIEEAVAFRQMIARMNGEFGAKGDWFFECWQPDTVLDARTGRTLPFHEAPPELLASD
FT                   PACWVLRPGAQWHGFGNLEDGYCMLDPIKVSIVTPGVAPAGGLMPVGIPASVVTAYLDA
FT                   RGIVVEKTTDFTILFLFSIGITKGKWGSLVSALCDFKRDYDANLPLDMAIPSLAKEHGA
FT                   RYAGMGLKDLADTMFAAMEQLGTTRLMSEAFSILPKPEMSPVRAYEHLVQGRVEQVTLD
FT                   ELAGRTVATGVVPYPPGIPLLMPGENAGPAGGPVLGYLKALEAYDRRFPGFAHDTHGVE
FT                   VEDGTYRVYCLTA"
     atgaatactt ccatcggcgg cattcgccgt ctcggcatgc gtgcgctact ggtcgacgac        60
     gagatcgcgc aggaaaccgc gaccgggcgc gcggtccgca cgctgagcgc ggagctcgcg       120
     caacgcgggg tcgacgtgct gacggccacg tccgccgacg atgccatcgt gctgatccgc       180
     tccgatccgt cgatccagtg cgtgctgctc gactgggatc tcggcgtgga cggtcacggg       240
     ccgtccgagg ctgtggtcga cgcgatccgg catcgcaacg gcagcgtgcc gatcttcctg       300
     ctggccgacc gcagcgtcgc gtcatcggta ccggccgcgg tgatgggcaa ggtcgacgat       360
     ttcgtgtggc tgctcgagga tacggccgat ttcatcggcg ggcgcattca cgcggcgatc       420
     gagcgctatc gctcgaccgt gctgccgccg atgttcggcg cgctcgcgaa gttctcgcgc       480
     gtctacgaat actcgtggca tacgccgggc cacaccggcg gcaccggctt cctgaaatcg       540
     ccggtcggcc gcgcgttctt cgagtacttc ggcgaatcgc tgttccgctc ggacctgtcg       600
     atctcggtgg gcgaactcgg ctcgctgctc gaccactcgg gcccgatcgg cgaaagcgaa       660
     cgctacgcgg cgcgcgtgtt cggcgcgcat cgcacgtatc acgtgacgaa tggctcgtcg       720
     acgtcgaacc gcatcatcct gatgacgagc gtgagccgcg accagatcgc gctgtgcgac       780
     cgcaactgcc acaagtcggc cgagcacgcg atgacgatgt cgggcgcgat tccgacctac       840
     ctcgtaccga cgcgcaaccg ctacgggatc atcggtccga tcgcgccgga gcgcctcacg       900
     caggtggcga tccgcgaggc gatcgcgtcg aacccgctcg cggccgggct ggccgatcgc       960
     cagccgaagc acgcgatcgt cacgaactcg acgtacgacg gcctttgcta caacgtgacg      1020
     cgcgtcgagg aactgctcgg cgcgagcgtc gaccggctgc acttcgacga agcgtggtac      1080
     ggctacgcgc gtttcaatcc gatctaccgc gaccgccatg cgatgcacgg cgacccgcgc      1140
     gaccaccaca aggatcggcc gacggtgttc gcgacacagt cgacgcacaa gctgctgacc      1200
     gcgctgtcgc aggcgtcgta catccacgtg cgcgatggcc gcagcccgat tccgcatggc      1260
     cagttcaacg aaacgttcat gatgcacgcg tcgacgtcgc cgaactacgc gatcatcgcg      1320
     tcgaacgacg tcgcggccgc gatgatggac ggccccggcg gcgccgcgct gacgcgcgag      1380
     tcgatcgagg aggccgtcgc gttccggcag atgatcgcgc ggatgaacgg cgaattcggc      1440
     gcgaagggag actggttctt cgaatgctgg cagcccgaca ccgtgctcga cgcgcgcacg      1500
     ggccgcacgc tgccgttcca cgaagcgccg cccgagctgc tcgcgagcga cccggcctgc      1560
     tgggtgctgc gccccggcgc gcaatggcac ggcttcggca atctcgagga cggctattgc      1620
     atgctcgacc cgatcaaggt gtcgatcgtc acgccgggtg tcgcgccggc cggcggcctg      1680
     atgccggtcg gcatcccggc gagcgtcgtc accgcgtatc tcgatgcgcg cgggatcgtc      1740
     gtcgagaaga cgaccgattt cacgatcctg ttcctgttct cgatcggtat cacgaagggc      1800
     aagtggggct cgctcgtcag cgcgctgtgc gatttcaagc gcgactacga cgcgaacctg      1860
     ccgctcgaca tggcgattcc gtcgctcgcg aaggagcatg gcgcgcgcta tgcgggcatg      1920
     gggctgaaag atctggccga cacgatgttc gcggcgatgg agcagctcgg cacgacgcgc      1980
     ctgatgtcgg aggcgttctc gatcctgccg aagccggaga tgagcccggt gcgcgcgtac      2040
     gagcacctcg tgcagggccg cgtcgagcag gtcacgctcg atgagctggc agggcgcacg      2100
     gtggccaccg gcgtcgtgcc gtatccgccg ggtattccgt tgttgatgcc gggcgagaac      2160
     gcggggccgg ccggcggccc ggtgctcggc tacctgaagg cgctcgaggc gtacgaccgg      2220
     cgtttccccg ggttcgcgca cgacacgcac ggcgtggagg tcgaggacgg cacgtaccgc      2280
     gtgtactgcc tgaccgcctg a                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page