(data stored in ACNUC1104 zone)

EMBL: CP000959.PE33

CP000959.PE33        Location/Qualifiers
FT   CDS_pept        37246..37899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3218"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bam:Bamb_3717 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92374"
FT                   /db_xref="GOA:B1K894"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B1K894"
FT                   /protein_id="ACA92374.1"
FT                   /translation="MSFKLYLSFLAASVVLIYAPGPVNLLTMNQALRTGWRRALPCVWG
FT                   GTLAVLLQLALTALCLNSLVHLDEHALTVLRWAGAAYLVWLGGKQWLSRTPAGAAAAPA
FT                   ETDAGTAIATPDTDGRALFWRGVATSGLNPKTLLFFPSFFPQFISPNADWSLNLQYLLL
FT                   AATFALLFAGGVASMALFSHRLSRALQRPARMRAMNRVTGGLLVGMGAIMVGWN"
     atgtcgttca agctttatct gtcgttcctc gctgcttccg tcgtcctcat ctacgcgccc        60
     ggccccgtca acctgctcac gatgaaccag gcgttgcgca ccggctggcg ccgcgcgctg       120
     ccgtgcgtct ggggcggcac gctcgccgtg ctgctgcaac tcgcgctgac cgcgctgtgc       180
     ctcaactcgc tggtccacct cgacgaacac gcactgacgg tgctgcgctg ggccggcgcc       240
     gcgtatctcg tctggctcgg cggcaagcaa tggctgagcc gcacgccggc cggcgcggcc       300
     gcggcgccgg ccgagaccga cgcaggaacg gccatcgcca cgccggacac cgacggacgc       360
     gcgctgttct ggcgcggcgt cgcgacttcc gggctgaatc cgaagacgct gctgttcttt       420
     ccgtcgttct ttccgcagtt catcagcccg aatgccgact ggagcctgaa ccttcaatac       480
     ctgctgctcg ccgcgacgtt cgcgctgctg ttcgcgggcg gcgtcgcatc gatggcgctg       540
     ttctcgcacc ggctgagccg cgcgttgcag cggccggcgc ggatgcgtgc gatgaaccgc       600
     gtgacgggcg ggctgctcgt cgggatgggt gcgatcatgg tcggctggaa ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page