(data stored in ACNUC1104 zone)

EMBL: CP000959.PE332

CP000959.PE332       Location/Qualifiers
FT   CDS_pept        396126..397085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3520"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2085
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92673"
FT                   /db_xref="GOA:B1K2M8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2M8"
FT                   /protein_id="ACA92673.1"
FT                   /translation="MEDIDLNLVTALDVLLSEASVTGAARRLGLSTSAMSRTLTRLRTA
FT                   TGDQLLVRAGRKLVPTPHAAALRDRVHAVASDARAVLRPATADVDLATLTATFTIRAAA
FT                   SFMEMLSGPVVAALGDVAPRVRIRFVPKLDRDPQALRDGTVDLEIGKRGDDAPELHTRM
FT                   LFHDWHVAVARAGHPLFASARITPARYAACRHVMAVQLGDFGGLADDSTANTGDGPAVH
FT                   VVVPGYPDAMRVAASTDLIALVPRSSLGNACSQGLTEALGLRSFEIPVRLPAILVSALW
FT                   HPRMHGDPVHRRLRDTVIAVCQRAYPDARPPRAAARGK"
     atggaagaca tcgacctgaa cctcgtcacc gcgctcgacg tgctgctgtc ggaagccagc        60
     gtgaccggcg ccgcgcgccg gctgggcctg agcacgtccg cgatgagccg cacgctcacg       120
     cggctgcgca ccgccaccgg cgaccagttg ctcgtgcgtg ccgggcgcaa gctcgtgccg       180
     acgccgcacg cagccgcgtt gcgcgaccgc gtgcatgccg ttgcgagcga cgcccgcgcc       240
     gtgctccggc cggcgacggc cgacgtcgac ctcgcgacgc tcacggccac gttcacgatc       300
     cgggcagccg cgtcgttcat ggaaatgctg tccggcccgg tggtggccgc actcggcgac       360
     gtcgcgccgc gcgtgcgtat ccgcttcgtc ccgaagctcg accgcgaccc gcaagcgctg       420
     cgcgacggca cggtcgacct cgaaatcggc aagcgcggcg acgacgcacc cgagctgcac       480
     acgcgcatgc tctttcacga ctggcacgtc gcggtggcgc gcgccggcca tccgctgttc       540
     gcgtcggccc ggatcacgcc cgcgcgctat gcagcctgcc gccacgtcat ggcggtccag       600
     ctcggcgatt tcggcgggct ggccgacgat tcgaccgcca acacgggcga cggccccgcc       660
     gtgcacgtcg tcgtgccagg ctacccggac gcgatgcgtg tcgcggccag caccgacctg       720
     atcgcgctgg tgccgcgctc gagcctcggc aacgcgtgct cgcaggggct caccgaagcc       780
     ctcgggctgc gcagtttcga gattcctgtc cgcctgccgg caatcctcgt gtccgcgctg       840
     tggcatccgc gcatgcacgg cgaccccgtg catcgccgcc tgcgcgatac ggtcatcgcc       900
     gtgtgccagc gcgcgtatcc ggatgcccgg ccgccacgcg cagcggcgcg cggcaagtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page