(data stored in ACNUC1104 zone)

EMBL: CP000959.PE335

CP000959.PE335       Location/Qualifiers
FT   CDS_pept        complement(399414..399626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92676"
FT                   /db_xref="GOA:B1K2N1"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2N1"
FT                   /protein_id="ACA92676.1"
FT                   /translation="MKNKIDKTAGPIWGVAAGLLLAGAGLSLGIFPAALRSAGSANDFM
FT                   ASGVAMLGIFLVVYSTHELRRKRSH"
     atgaaaaaca aaatcgacaa gaccgccgga ccgatctggg gcgtggcagc aggattgctt        60
     cttgctgggg caggattgag tctgggtatt ttccccgcgg cgttgcgcag cgcgggcagc       120
     gcaaacgact tcatggcgtc gggcgtcgcg atgctgggca tcttcctcgt cgtctattcg       180
     acgcacgaac tgcgaagaaa acgctcgcac tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page