(data stored in ACNUC1104 zone)

EMBL: CP000959.PE343

CP000959.PE343       Location/Qualifiers
FT   CDS_pept        complement(405601..405885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3532"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="SMART: regulatory protein LacI; KEGG:
FT                   bur:Bcep18194_B2717 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92684"
FT                   /db_xref="GOA:B1K330"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1K330"
FT                   /protein_id="ACA92684.1"
FT                   /translation="MAAEMSVATVSKYVNGTKRFSPEVEFRLKQTIEKLGYQTRPLARS
FT                   MITGRTRTIGLVILDISNPHFASVVKGANRTALAHDYAAARRYGRGCGA"
     atggcagccg agatgtctgt cgcgaccgta tcgaaatatg tcaacgggac caagcgcttc        60
     tcgccggaag ttgagttccg cctgaagcag accatcgaga aactgggcta ccagacacgc       120
     ccgcttgcgc gctcgatgat tacggggcgc acacgaacga tcggcctcgt cattctcgat       180
     atcagcaatc cacacttcgc gagcgtcgtg aaaggggcca atcgaacggc gctcgcgcac       240
     gactacgctg ctgctcgtcg atacggaaga ggatgcggcg cgtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page