(data stored in ACNUC1104 zone)

EMBL: CP000959.PE344

CP000959.PE344       Location/Qualifiers
FT   CDS_pept        complement(405970..407016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3533"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rle:RL0302 putative AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92685"
FT                   /db_xref="GOA:B1K331"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B1K331"
FT                   /protein_id="ACA92685.1"
FT                   /translation="MLYSAIYLRDSTMMSDDPFSDILRLTNAESLATGGFSAGGAWAVR
FT                   FPAPDKIKFFAVVKGTCWVSIDGEETPIRFGSGDVGLLTAKRAFVLASDPCVPPVDAMA
FT                   LFSGAGRSTVKLGNGDEFAQIGGHVLLDPVTGSLLSDVLPPWIHVPAASPQAVKVRWLL
FT                   EKLVEERAADLPGAQLVSAQLSQLLFIQILRAHLKTSASLTGWLRAFGNPRIAPALRLM
FT                   YGDPARSWHLDELAAACAMSRTTFASHFRASAGVAPLTYLGEWRMRLAERRLRDEDIPV
FT                   ALLAQSLGYSSESAFSHAFKRMSGHSPTAYRHVVRTAAEGAGSGRGGIRAAVEATGATP
FT                   QPFPLEPR"
     atgctctata gtgcgattta cttgcgcgac agtacgatga tgagtgacga ccccttctcc        60
     gacatcctga ggctcacgaa cgccgaatcg ctggcgacgg gaggcttctc cgccggcggc       120
     gcttgggctg tgcgatttcc ggcacccgac aagatcaagt tctttgcggt ggtgaagggc       180
     acgtgctggg tctccatcga cggagaagaa acgcctatcc gctttggaag cggtgacgtc       240
     ggattgttga cggcgaaacg cgccttcgtc ctcgcaagtg atccttgcgt gccacccgtc       300
     gacgcgatgg cgttgttctc gggcgccgga aggtcgacgg tgaaactcgg caacggcgat       360
     gaattcgcgc agatcggcgg gcacgtattg ctcgatccgg tcaccggcag cttgctatcg       420
     gatgttctgc cgccatggat tcacgtaccg gccgcatcgc cgcaggcagt gaaggtccgc       480
     tggcttctcg agaaactcgt ggaagagcgt gcggccgatc tgcccggcgc gcaactcgta       540
     tcggcccagc tttcacagct gctcttcatt cagatattgc gcgcccattt gaaaacgtcc       600
     gcgtccttga cgggatggct gcgcgcgttc ggcaacccgc gcatcgcacc cgcactgcgg       660
     ttgatgtacg gcgaccccgc gcgttcatgg catctggatg agcttgccgc cgcgtgtgcg       720
     atgtcacgga ccacgttcgc ttctcacttc agggcgagcg ccggtgtcgc accgctgacc       780
     tatctgggag agtggcgtat gcgtcttgcg gagcgccgtt tgcgcgacga ggacatcccg       840
     gtggccctgc ttgcgcagtc gctcggttac tcgtccgaaa gcgcattcag tcacgcgttc       900
     aagcgcatgt ccgggcattc accgaccgca tatcgccatg tcgtacggac tgctgctgaa       960
     ggcgcgggca gcgggcgcgg cggcattcgc gcggccgtgg aggctaccgg tgcgactccg      1020
     cagccgtttc cgttggaacc tcggtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page