(data stored in ACNUC1104 zone)

EMBL: CP000959.PE349

CP000959.PE349       Location/Qualifiers
FT   CDS_pept        412487..413542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3538"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: rle:RL0304 putative CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92690"
FT                   /db_xref="GOA:B1K336"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K336"
FT                   /protein_id="ACA92690.1"
FT                   /translation="MNGNINDVSVLVTGGTGFIAQHCILALLNRGYQVRTTVRSLARET
FT                   QVRAQLERGGAEPGGRLSFVEADLLADDGWQQATAGSTYVVHGASPTPTGTQTSEDDWV
FT                   KPAVAGTLRVLRAARDAGVKRVVLTSAFGAICAGHGPMRRPFDETDWSNLAAADVWPYQ
FT                   KSKTLSERAAWDFVAREGRGMQLSAINPVTVLGPVLGDDYSHSIRLIRGMLDGQPGNPR
FT                   INSGFVDVRDVADLHVRAMTHEAANGERFIAIAGESMWLAEVAQVLKARMGDAARHVST
FT                   RVLPDWLVRIGALRDPALRGSLPLLGRNLNATSQKASSLLGWSPRPREDAIVATAESLV
FT                   SLGLLRDAGRR"
     atgaacggca acatcaacga cgtatcggtt ctcgtaacag gcggcaccgg cttcattgca        60
     caacactgca tcctggcgct gctgaatcga ggctatcagg tacgaaccac cgttcgctcg       120
     ctcgcacgcg agacgcaggt gcgcgcccag ctcgaaagag gcggcgcgga acccggaggc       180
     cgtctgtcat tcgtcgaggc ggatctcctc gccgacgacg gctggcaaca ggccactgcc       240
     ggcagcacct acgtcgtgca tggcgcgtcg cccacgccta ccggcacgca gacgagcgaa       300
     gacgattggg tcaagcccgc cgtggcaggc acgctgcgtg tgctgcgtgc ggcgcgggac       360
     gccggcgtca agcgcgtcgt gctgacctcc gctttcggtg cgatctgcgc cggacacggg       420
     ccgatgcgcc gccccttcga cgagaccgac tggagcaacc tggcggccgc cgatgtctgg       480
     ccttatcaga agtcgaagac cttgtcggag cgcgcggcct gggatttcgt cgcgcgagaa       540
     ggacgcggca tgcaactgtc cgcgatcaat ccagtgacgg ttctcgggcc cgtgctcggc       600
     gacgactatt cgcattccat ccgcctgatc aggggcatgc tggacggcca gcccggcaat       660
     ccgcgaatca attccggctt cgtcgacgtg cgcgatgtcg ccgacctgca tgtgcgagcc       720
     atgacccacg aagccgcgaa cggcgagcgc ttcattgcca ttgcaggcga aagcatgtgg       780
     ctcgccgaag tcgcgcaagt gctcaaggcg cgcatggggg acgccgcgcg ccatgtgtcg       840
     acccgggtgc tgcctgactg gctggtacgc atcggcgcgc tcagggatcc cgcgctgcgc       900
     ggatcgttgc cgctgctcgg ccgcaatctg aacgccacca gccagaaggc cagcagcttg       960
     ctcggctggt cgccccgccc gcgcgaggac gccatcgtcg ccacggccga aagcctcgtg      1020
     agcctggggc tactgcgcga tgccggccgg cgatag                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page