(data stored in ACNUC1104 zone)

EMBL: CP000959.PE35

CP000959.PE35        Location/Qualifiers
FT   CDS_pept        39259..39690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3220"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bam:Bamb_3715 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92376"
FT                   /db_xref="GOA:B1K896"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1K896"
FT                   /protein_id="ACA92376.1"
FT                   /translation="MSELLTYGGLFAVSMVAATLLPLQSEAVLAGLLLAGREPVWALVL
FT                   VASVGNVAGSAINWALGRGIEHFRERRWFPVKPSALARAERWYARYGRWSLLLSWAPVI
FT                   GDPLTMIAGVLREPLPTFLAIVTIAKVGRYLAVAWLVMH"
     atgtccgaat tgctcactta cggcggcctg ttcgccgtgt cgatggtcgc cgcgaccctg        60
     ttgccgctcc agtccgaagc cgtgctcgcc ggcctgctgc tcgccgggcg cgaacccgtg       120
     tgggcgctgg tgctggtcgc gagcgtcggc aacgtcgccg gctcggcgat caactgggcg       180
     ctcggccgcg gcatcgagca ttttcgcgag cgccgctggt ttccggtcaa gccatccgcg       240
     ctcgcgcgcg ccgagcgctg gtacgcacgc tacggccgct ggtcgctgct gctgagctgg       300
     gcgccggtga tcggcgatcc gctgacgatg atcgccggcg tgctgcgcga gccgctgccg       360
     acctttctcg cgatcgtgac gatcgcgaaa gtcggccgct atctggccgt cgcgtggctc       420
     gtcatgcact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page