(data stored in ACNUC1104 zone)

EMBL: CP000959.PE350

CP000959.PE350       Location/Qualifiers
FT   CDS_pept        complement(413803..415728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3539"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3; KEGG: bur:Bcep18194_B2095 translation
FT                   elongation factor, selenocysteine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92691"
FT                   /db_xref="GOA:B1K337"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K337"
FT                   /protein_id="ACA92691.1"
FT                   /translation="MIVGTAGHIDHGKTTLVRALTGVDTDRLKEEKARGISIELGYAYT
FT                   PLGNGDVLGLIDVPGHEKLIHTMAAGACGIDFALLVIAADDGVMPQTREHLAILQLLGV
FT                   THGAVALTKCDRVDAARVAEVRDEIAVWLHDSTLAGVPIFETRATAADDSGVAALKQHL
FT                   ADAAIAWRTRRDDGLFRLAVDRVFTLAGQGTVVTGTAFAGRVATGDTLAIVRTGGAARV
FT                   RSIHAQNRPVEAGRAGERCALNLAGVDKADIERGDTVADARLVATSPRLDVELTLLADA
FT                   GLTLTHWAPLHVHLGTLHRVAHVALLDGDTLAAGQRMRVQLVFDEPVFALPGDRFIVRN
FT                   PQATRTVGGGRVLDPFGPARKRRTPARRAWLDALAAWLDEGRLDALLAQAPLGMARATL
FT                   THLTGFAPDALALPDDALAIGQRDAAANEGAVISHAHWRALQTRAVDTLRAYHERMPDE
FT                   QGLDAARLRRMAAPLVGDTLWRALVDALVTGGEVARSGPWLHLPSHSVSLEPREEALAR
FT                   QLLPLIHAGRFDPPWVRDLARDTGAAEDAVRTLLRKLARRGDVHQVVRDLFYHADIARE
FT                   LAELVAHLAPSRGGGLDAATFRDATGLGRKRAIQILEFFDRVGYTRFHRDLHYLRPDSG
FT                   WAGIQA"
     atgatcgtcg ggaccgcggg gcacatcgac cacggcaaga ccacgctcgt gcgcgcgctg        60
     acgggcgtcg acaccgatcg cctgaaggaa gagaaggcgc gcggcatttc gatcgaactc       120
     ggctacgcgt atacgccgct cggcaacggc gacgtgctcg gcctgatcga cgtgccgggc       180
     cacgagaagc tgattcatac gatggccgcc ggcgcgtgcg gcatcgactt cgcactgctc       240
     gtgattgccg ccgacgacgg cgtgatgccg cagacgcgcg agcatctcgc gatcctgcaa       300
     ctgctcggcg tcacgcatgg cgccgtcgcg ctgacgaaat gcgatcgcgt cgatgccgcg       360
     cgcgttgccg aggtgcgcga cgagatcgct gtctggctgc acgactcgac gctggccggc       420
     gtgccgatct tcgaaacgcg tgcaacggcg gccgacgatt cgggcgtcgc cgcgttgaag       480
     cagcacctgg ccgacgcggc gatcgcgtgg cgcacgcgtc gcgacgacgg gttgttccgg       540
     ctcgcggtcg atcgcgtgtt tacgctcgcc gggcagggca ccgtcgtgac gggtaccgcg       600
     ttcgcgggcc gcgtcgcgac cggcgacacg ctcgcgatcg tgcgcaccgg cggcgcggcc       660
     cgcgtgcgca gcatccatgc gcagaaccgg ccggtcgagg ccggccgcgc gggcgagcgt       720
     tgcgcgctga acctggccgg cgtcgacaag gcagacatcg agcgaggcga caccgtcgcc       780
     gatgcgcggc tcgtcgcgac gtcgccgcgc ctggacgtcg agctgacgtt gctcgcggac       840
     gccgggctga cgctgacgca ctgggcgccg ctgcacgtgc atctcggcac gctgcatcgc       900
     gtggcccacg tcgcgctgct ggacggcgac acactcgccg ccggccagcg gatgcgcgtg       960
     caactggtgt tcgacgagcc ggtgttcgcg ctgccgggcg accgcttcat cgtccgcaat      1020
     ccgcaggcga cgcgcaccgt cggcggcggc cgcgtgctcg atccgttcgg gccggcccgc      1080
     aagcgccgta cgccggcgcg ccgcgcgtgg ctcgatgcgc tcgcggcgtg gctcgacgaa      1140
     gggcgcctcg atgcgctgct cgcgcaggcg ccgctcggca tggcgcgcgc gacgctcacg      1200
     catctgacgg gattcgcacc cgatgcgctg gcgttgccgg acgatgcgct ggcaatcggc      1260
     caacgcgatg ccgcggcgaa cgaaggcgcg gtgatttcgc atgcgcactg gcgggccttg      1320
     cagacgcggg cggtcgacac gctgcgcgcg taccacgaac gcatgcccga cgagcagggg      1380
     ctcgacgccg cacgcctgcg acggatggct gcgccgctcg tcggcgatac gctgtggcgc      1440
     gcgctcgtcg atgcgctggt gacgggcggc gaggtcgcgc gcagcgggcc gtggctgcat      1500
     ctgccgtcgc attcggtgag cctcgagccg cgcgaggaag cgttggcgcg gcaactgctg      1560
     ccgctgatcc acgcggggcg cttcgatccg ccgtgggtgc gcgacctggc ccgcgacacg      1620
     ggtgcggccg aggatgcggt gcgcacgctg ctgcgcaagc tcgcgcggcg cggcgacgtg      1680
     caccaggtcg tgcgcgacct gttctatcac gcggacatcg cgcgcgaact ggcggagctg      1740
     gtcgcgcatc tcgcaccgtc gcgcggcggc gggctcgatg ccgcgacgtt ccgcgacgcg      1800
     acggggctcg gtcgcaagcg cgcgatccag attctcgagt tcttcgatcg ggttgggtat      1860
     actcgcttcc accgcgatct tcactacctg cggcctgaca gcggttgggc gggtattcag      1920
     gcgtag                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page