(data stored in ACNUC1104 zone)

EMBL: CP000959.PE352

CP000959.PE352       Location/Qualifiers
FT   CDS_pept        complement(417239..418174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3541"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   bur:Bcep18194_B2097 formate dehydrogenase accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92693"
FT                   /db_xref="GOA:B1K339"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:B1K339"
FT                   /protein_id="ACA92693.1"
FT                   /translation="MTQRILEPTEISALDHSAIPRFRLPERATAFAARAARLRKLADLN
FT                   PISGYLRLMATVADAQHATLQALELPLPSKEAIARAQEHSMPLVPALDGERDARWRAVL
FT                   YELLDRVESAGLVNPQLAKLLDRLRLMAPAELDAQADAILALRFAEVDPATAPFLMAAL
FT                   QVVWTDLASRVTPTDVPYLDQPGLCPVCGTHPVASVVRVGGQYQGYRFLQCGLCTTEWH
FT                   MVRTKCSHCDSTKGIAYHGIEGGSEAVKAESCDECKTYRKIGYQEKDYEFEPLADDLAS
FT                   LTLDLLMNEAGYQRSSPNPLLWPDVSREAD"
     gtgacacaac gcattctgga gccgaccgag atctcggcac tcgatcattc ggccattccg        60
     cgctttcgcc tgccggagcg cgcgaccgcg ttcgcggcgc gggccgcgcg gctgcgcaag       120
     ctggccgacc tgaacccgat cagcggctac ctgcggctga tggccaccgt cgccgacgcg       180
     cagcacgcga cgctgcaggc gctggagctg ccgctgccgt cgaaggaagc gatcgcacgc       240
     gcgcaggaac attcgatgcc gctcgtgccg gcgctcgacg gcgaacgcga tgcgcgctgg       300
     cgcgccgtgc tgtatgaact gctcgaccgc gtcgaaagcg ccgggctcgt caacccgcag       360
     ctcgcgaagc tgctcgaccg gttgcgcctg atggcgcccg ccgagctcga cgcgcaggcc       420
     gatgcgatcc tcgcgctgcg cttcgccgag gtcgatccgg ccaccgcgcc gttcctgatg       480
     gccgcgctgc aggtcgtatg gacggacctc gcgagccgcg tgacgcccac cgatgtcccg       540
     tatctcgacc agccggggct gtgcccggtg tgcggcacgc atccggtcgc gagcgtcgtg       600
     cgggtcggcg gccagtatca gggctaccgt ttcctgcagt gcgggctgtg cacgaccgag       660
     tggcacatgg tgcgcaccaa gtgctcgcac tgcgattcga cgaagggcat cgcgtatcac       720
     gggatcgaag gcggcagcga agccgtcaag gccgaatcgt gcgacgagtg caagacctat       780
     cgcaagatcg gctatcagga gaaggactac gagttcgagc cgctggcgga cgatctcgcg       840
     agtctcacgc tcgacctgct gatgaacgag gccggctacc agcgcagttc gccgaacccg       900
     ctgctgtggc cggacgtgtc gcgggaagcg gactga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page