(data stored in ACNUC1104 zone)

EMBL: CP000959.PE353

CP000959.PE353       Location/Qualifiers
FT   CDS_pept        complement(418565..419191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3542"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   bur:Bcep18194_B2098 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92694"
FT                   /db_xref="GOA:B1K340"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B1K340"
FT                   /protein_id="ACA92694.1"
FT                   /translation="MSHDDPNLIVRYTPNERTNHWITAITFVLLALSGLALFHPSMFWL
FT                   TALFGGGQWTRILHPFVGLVMFVSFAILVVRFWHHNALDADDRQWLKQIGDVLTNQEDK
FT                   LPPVGRYNAGQKLLFFTLVACLLLLLLSGIVIWRRYFSFYFPIGVIRAAAVVHAVAAFV
FT                   LIASIIVHIYAALWVKGSIGAMVRGTVTLGWARKHHPKWFRESVK"
     atgagccacg acgaccccaa cctgatcgtc cgctacacgc cgaacgagcg cacgaaccac        60
     tggatcaccg cgatcacgtt cgtgctgctc gcgttgtccg ggctcgcgct gttccatccg       120
     tcgatgttct ggctgaccgc gctgttcggc ggcggccagt ggacgcgcat cctgcatccg       180
     ttcgtcggcc tcgtgatgtt cgtgtcgttc gcgattctcg tggtgcgctt ctggcaccac       240
     aatgcgctcg acgcggacga tcgccaatgg ctgaagcaga tcggcgacgt gctgaccaac       300
     caggaagaca agctgccgcc ggtcgggcgc tataacgccg gacagaagct gctattcttc       360
     acgctggtgg cgtgcctgct gctgctcctg ctgtcgggaa tcgtgatctg gcggcgctac       420
     ttctcgttct acttcccgat cggggtgatc cgcgcggccg ctgtcgtgca tgccgtggcg       480
     gccttcgtgc tgatcgcgag catcatcgtg cacatttacg cggcgttgtg ggtgaagggt       540
     tcgatcggtg cgatggtgcg cggcaccgtc acgctgggct gggcccgcaa gcatcacccg       600
     aagtggttcc gtgaaagcgt gaaatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page