(data stored in ACNUC1104 zone)

EMBL: CP000959.PE354

CP000959.PE354       Location/Qualifiers
FT   CDS_pept        complement(419188..420102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3543"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   bvi:Bcep1808_4487 formate dehydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92695"
FT                   /db_xref="GOA:B1K341"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:B1K341"
FT                   /protein_id="ACA92695.1"
FT                   /translation="MALQSLDIKRVSATTTPPPTVREPVTGSVAKLIDVSKCIGCKACQ
FT                   TACMEWNDLRDEVGTNVGVYDNPADLSEHSWTVMRFSEYENPAGDLEWLIRKDGCMHCE
FT                   DPGCLKACPSPGAIVQYNNGIVDFHEENCIGCGYCVTGCPFNVPRISKKDHRAYKCTLC
FT                   SDRVAVGQEPACVKTCPTGAIVFGTKEDMKQHAAERIEDLKERGFEHAGLYDPQGVGGT
FT                   HVMYVLHHADKPSLYHGLPDNPSISPMVKLWKGIAKPLAVAGLALTALAGFFHYTRVGP
FT                   NEVTDEEEAAARDEARRIKEDAK"
     atggcattgc aatcgctgga tatcaagcgg gtctcggcca ccacgacgcc accgcccacg        60
     gtgcgcgaac cggtgaccgg gagcgtcgcg aagctgatcg acgtatcgaa gtgcatcggc       120
     tgcaaggcat gccagacggc atgcatggag tggaacgacc tgcgcgacga agtcggcacc       180
     aacgtcggcg tgtacgacaa cccggccgac ctgagcgagc attcgtggac ggtcatgcgg       240
     ttctccgaat acgagaaccc ggcgggcgac ctcgagtggc tgatccgcaa ggacggctgc       300
     atgcactgcg aggacccggg ctgcctgaag gcgtgcccgt cgccgggcgc gatcgtgcag       360
     tacaacaacg ggatcgtcga cttccacgag gagaactgca tcggttgcgg ctattgcgtg       420
     accggttgcc cgttcaacgt gccgcggatc tcgaagaagg atcatcgcgc gtacaagtgc       480
     acgctctgtt ccgaccgcgt cgcggtcggc caggaaccgg cctgcgtgaa gacctgcccg       540
     acgggcgcga tcgtgttcgg caccaaggag gacatgaagc agcatgcggc cgagcggatc       600
     gaggacctga aggagcgcgg cttcgagcat gcggggctgt acgacccgca gggcgtcggc       660
     ggcacgcacg tgatgtacgt gctgcaccac gcggacaaac cgtcgctgta ccacgggttg       720
     cccgacaacc cgtcgatcag cccgatggtg aagctgtgga agggcatcgc gaaaccgctc       780
     gcggtcgcgg gcctcgcgct gaccgcgctg gccggcttct tccactacac gcgggtcggt       840
     ccgaacgagg tcaccgacga ggaggaagcc gctgcccgcg acgaggcacg acgcatcaag       900
     gaggacgcga aatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page