(data stored in ACNUC1104 zone)

EMBL: CP000959.PE355

CP000959.PE355       Location/Qualifiers
FT   CDS_pept        complement(420113..422545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3544"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molydopterin dinucleotide-binding region; KEGG:
FT                   bur:Bcep18194_B2100 formate dehydrogenase, alpha subunit,
FT                   anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92696"
FT                   /db_xref="GOA:B1K342"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B1K342"
FT                   /protein_id="ACA92696.1"
FT                   /translation="MTNHWVDIKNADVILVMGGNAAEAHPCGFKWVTEAKAHRKARLIV
FT                   VDPRFTRTASVADYYAPIRTGTDIVFLGGVINYLLTNDKIQHEYVKNYTDFSFIVREDF
FT                   AFNDGIYSGYDAEKHAYPDKSSWDYERGDDGFAKVDPTLQHPRCVYNLLKQHYARYTAE
FT                   MVQQVCGTPKEKFLKVCEMLATTAVPGRAGTVLYALGWTHHSIGAQIIRTGAMVQLLLG
FT                   NIGIAGGGMNALRGHSNIQGLTDLGLMSNLLPGYMTLPMQAEQDFDAYIKKRVQQPLRP
FT                   NQLSYWKNYKAFHVSFMKSWWGDAATAENNWAYDYLPKLDKQYDLLQAIELMNAGKMNG
FT                   YICQGFNPLAAAPSKVKTAAGLAKLKWLVIMDPLATETSEFWKHHGDYNDVDASKIQTE
FT                   VFRLPTTCFAEENGSLVSSSRVLQWHWKGAEPPGEARSDLEIMSGLFLRMRKLYQKDGG
FT                   KYPDPIVNLTWPYANPESPTPEELAMEFNGKALADLPDPKDPAKTLVKKGEQLAAFAQL
FT                   KDDGTTASGCWIFCGAWTQAGNQMGRRDNSDPTGIGQTLNWAWAWPANRRILYNRASCD
FT                   VAGKPFDPTRKLIGWNGSAWKGADVPDFKADEPPENGMGPFIMNPEGVARFFARAGMNE
FT                   GPFPEHYEPFETPLGANPLHPNNPLALNNPAARVFPDDRASFGKVADFPHVATTYRLTE
FT                   HFHYWTKHARLNAIIQPEQFVEIGEDLAKEVGVAHGERVKVSSKRGYIIAVALVTKRIK
FT                   PLTVDGKKVQTVGVPLHWGFKGLTKPGYLANTLTPSVGDGNSYTPEFKSFLVKVEKA"
     atgacgaacc attgggtcga catcaagaac gcggacgtga ttctcgtgat gggcggcaat        60
     gcagccgagg cccatccgtg cggtttcaag tgggtaacgg aggcgaaggc gcaccgcaag       120
     gcgcggctga tcgtcgtcga cccgcgcttc acgcgtacgg cctcggtggc cgattattac       180
     gcgccgatcc gcaccggcac cgacatcgtc ttcctgggcg gcgtcatcaa ctatctgctg       240
     acgaacgaca agatccagca tgagtacgtg aagaactaca cggacttctc gttcatcgtg       300
     cgcgaggatt tcgcgttcaa cgacggcatc tattccggct acgacgccga gaagcacgcg       360
     tacccggaca aatcgagctg ggactacgag cgcggcgacg acggtttcgc gaaggtcgat       420
     ccgacactgc agcatccgcg ttgtgtatac aacctgctga agcagcacta cgcgcgctat       480
     acggcggaga tggtccagca ggtctgcggc acgccgaagg agaaattcct gaaggtgtgc       540
     gagatgctcg cgaccacggc cgtgcccggc cgcgccggca cggtgctgta cgcgctcggc       600
     tggacccacc actcgatcgg cgcgcagatc atccgcaccg gcgcgatggt gcagttgctg       660
     ctcggcaaca tcggcatcgc cggcggcggg atgaacgcgc tgcgcggcca ctcgaacatc       720
     caggggctga ccgacctcgg gctgatgtcg aacctgctgc cgggctacat gacgctgccg       780
     atgcaggccg agcaggattt cgacgcgtac atcaagaagc gcgtgcagca gccgctgcgg       840
     ccgaaccagt tgagctactg gaagaactac aaggcgttcc acgtcagctt catgaagtcg       900
     tggtggggcg acgcggccac cgcggagaac aactgggcct acgactacct gccgaagctg       960
     gacaagcagt acgacctgct gcaggcgatc gagctgatga atgccggcaa gatgaacggc      1020
     tacatctgcc agggcttcaa cccgctcgcg gcggcgccgt cgaaggtgaa gacggcggcg      1080
     ggcctcgcga agctgaaatg gctcgtgatc atggatccgc tcgcgaccga gacgtccgag      1140
     ttctggaagc accacggcga ctacaacgac gtcgatgcgt cgaagatcca gaccgaggtg      1200
     ttccgtctgc cgaccacctg cttcgcggag gaaaacggct cgctcgtgag ttcgagccgc      1260
     gtgctgcagt ggcactggaa gggcgcggag ccgccgggcg aagcgaggag cgacctcgag      1320
     atcatgtcgg ggctgttcct gcgcatgcgc aagctgtacc agaaggacgg cggcaagtat      1380
     ccggacccga tcgtgaacct gacctggccg tacgcgaacc cggagagccc gacgcccgag      1440
     gaactggcga tggagttcaa cgggaaagcg ctcgccgatc tgcccgatcc gaaggacccg      1500
     gcgaagacgc tcgtgaagaa gggcgagcag ctcgccgcgt tcgcgcaact gaaggacgac      1560
     ggcacgaccg cgagcggctg ctggatcttc tgcggcgcat ggacccaggc cggcaaccag      1620
     atggggcggc gcgacaactc cgatccgacc ggcatcggcc agacgctgaa ctgggcgtgg      1680
     gcgtggccgg cgaaccggcg catcctgtac aaccgcgcgt cgtgcgacgt cgccggcaag      1740
     ccgttcgacc cgacccgcaa gctgatcggc tggaacggca gcgcgtggaa gggcgccgac      1800
     gtgccggact tcaaggcgga cgaaccgccc gaaaacggga tggggccgtt catcatgaat      1860
     ccggaaggcg tcgcgcgctt cttcgcccgc gcggggatga acgaaggtcc gttccccgag      1920
     cactacgagc cgttcgagac gccgctcggc gcgaacccgt tgcacccgaa caacccgctg      1980
     gcgctgaaca acccggccgc ccgcgtgttc ccggacgacc gcgcgtcgtt cggcaaggtg      2040
     gcggacttcc cgcacgtggc gaccacgtac cggctgaccg agcatttcca ctactggacc      2100
     aagcatgcgc ggctgaacgc gatcatccag cccgagcaat tcgtcgagat cggcgaagac      2160
     ctcgcgaagg aggtcggcgt cgcgcatggc gagcgcgtga aggtgtcgtc caagcgcggc      2220
     tacatcatcg cggtcgccct cgtcacgaag cggatcaagc cgctgacggt cgacggcaag      2280
     aaggtccaga cggtcggcgt cccgttgcac tggggcttca agggtctgac gaagcccggc      2340
     tatctcgcca ataccctgac tccgtccgtg ggtgacggca actcctatac accggaattc      2400
     aagtcgttcc tggtgaaggt cgaaaaggcg taa                                   2433
//

If you have problems or comments...

PBIL Back to PBIL home page