(data stored in ACNUC1104 zone)

EMBL: CP000959.PE36

CP000959.PE36        Location/Qualifiers
FT   CDS_pept        39830..41812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3221"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bam:Bamb_3714
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92377"
FT                   /db_xref="GOA:B1K897"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B1K897"
FT                   /protein_id="ACA92377.1"
FT                   /translation="MRMTQLGRVSVGARLAALACALVALLFTVFAWTLAHFAGQQLADE
FT                   AHKRIDDKEQSIRAMVDLFDKALTAEANRSMSLFASFLPADFSLDPARTVDIGGVAAPT
FT                   LLAGGQPLDLDYSIPDQFLKKSGAIATIFARDGDDFVRITTSLKKQDGARAVGTKLDRA
FT                   GPAYAPLVAGRSYTGLAKLFGRSYITQYKPVTDATGRVIGALFVGLDIGAELKLVEDGI
FT                   RALKIGDNGYYFVLDASQGPSRGTFVVHPDAAGQRADDTRAPYAQMLAAAQGRLAYTSA
FT                   DPAAHDAGPTAKFVSFTTIPQWQWLVGGIALDDELLATMRATRNRFLMIGAVLVAAFAT
FT                   LFVIVVRRVVSRPLEAAARASERYAAGDLSVRIRDGAAAHGSAANDEIGRLVQAVDGIG
FT                   DGLARIVAQVRNGAADIAHGTVGIAAGSGDIAARIATQASSVEQTAASMEQITAAVQQS
FT                   AEHAAQANALVADASAAATNGDAAVQRVVATMDDIGRATRRIAEITGAIEGIAFQTNIL
FT                   ALNAAVEAARAGEHGKGFAVVAAEVRALAQRSAAAVKEIDALSAESSTTVEQGYRIADA
FT                   ARGTMRDIVARVDQVRTLIGEISAASREQSTGIEQVNLAVTQIGEATQQNALLISDAER
FT                   AAVALREQAAQLSDAVSVFRLARDA"
     atgagaatga cccaattggg ccgagtgagc gtcggcgcgc gtctggccgc gctggcgtgc        60
     gcgctcgtcg ccctgctgtt taccgtgttc gcgtggaccc tcgcccattt cgccggccag       120
     cagctcgccg atgaagcgca taagcggatc gacgacaagg agcagtcgat ccgcgcgatg       180
     gtcgacctgt tcgacaaggc gttgaccgcc gaagccaacc gctcgatgtc gctgttcgcg       240
     agtttcctgc cggccgattt ctcgctcgac ccggcgcgca ccgtcgacat cggcggcgtg       300
     gccgcgccga ccctgctcgc gggcggccag ccgctcgacc tcgactactc gattcccgac       360
     cagttcctga agaaaagcgg cgcgatcgcg acgatcttcg cgcgcgacgg cgacgatttc       420
     gtgcgcatca cgacctcgct gaagaagcag gacggcgcgc gcgcggtcgg taccaagctc       480
     gaccgcgccg gccccgcgta tgcaccgctg gttgccgggc gcagctacac gggcctcgcg       540
     aagctgttcg gccggtcgta catcacgcag tacaagccag tgaccgacgc gaccggccgc       600
     gtgatcggcg cgctgttcgt cggtctcgac atcggcgccg agctcaagct cgtcgaggac       660
     ggcatccgtg cgctgaagat cggcgacaac ggctactact tcgtgctcga tgcgtcgcaa       720
     ggcccgtcgc gaggcacctt cgtcgtgcat cccgatgcgg ccggccagcg tgccgacgac       780
     acgcgcgcac cctacgcgca gatgctcgcg gcggcccagg gccggctcgc gtacacgtcg       840
     gccgaccccg ccgcgcacga cgccgggccg accgcgaagt tcgtgtcgtt cacgacgatt       900
     ccgcaatggc aatggctcgt cggcgggatc gcgctcgacg acgagctgct ggccaccatg       960
     cgcgccaccc gcaaccgctt cctgatgatc ggcgccgtgc tcgtcgcggc gttcgcgacg      1020
     ctgttcgtca tcgtcgtgcg acgcgtggtg agccggccgc tggaagccgc cgcccgtgcg      1080
     tcggagcgct atgcggcggg cgatctcagc gtgcgcatcc gcgacggcgc ggccgcgcac      1140
     ggcagcgcgg ccaacgacga gatcggccgg ctcgtgcagg cggtcgacgg gatcggcgac      1200
     ggcctcgcgc ggatcgtcgc gcaagtgcgc aacggcgcgg ccgacatcgc gcacggcacg      1260
     gtcggcatcg cggccggtag cggcgacatc gccgcgcgga tcgcgacgca ggccagcagc      1320
     gtcgaacaga cggccgccag catggagcag atcaccgccg ccgtgcagca gagcgccgag      1380
     cacgcggcgc aagccaacgc gctggtcgcg gatgcgtcgg ccgccgcgac gaacggcgac      1440
     gccgcggtgc agcgcgtggt cgcgacgatg gacgacatcg gccgcgcgac gcgccggatc      1500
     gccgagatca ccggcgcgat cgaaggcatc gcgttccaga ccaacatcct cgcgctgaac      1560
     gcggccgtcg aggccgcccg cgcgggcgaa cacggcaagg gcttcgcggt ggtcgcggcc      1620
     gaggtgcgcg cgttggcgca gcgcagcgcg gccgcggtca aggagatcga cgcgctgagc      1680
     gccgaatcgt cgacgaccgt cgaacagggt taccggatcg cggacgccgc gcgcggcacg      1740
     atgcgcgaca tcgtcgcgcg ggtcgaccag gtgcgcacgc tgatcggcga gatcagcgcc      1800
     gcgtcgcgcg aacaatcgac cggcatcgag caggtgaatc tggccgtcac gcagatcggc      1860
     gaagcgacgc agcagaatgc gctgctgatc tcggacgccg agcgcgcggc cgtcgcgttg      1920
     cgcgagcagg ccgcgcaact gtcggacgcc gtcagcgtgt tccgactcgc acgcgacgcg      1980
     tga                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page