(data stored in ACNUC1104 zone)

EMBL: CP000959.PE360

CP000959.PE360       Location/Qualifiers
FT   CDS_pept        complement(426870..427853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3549"
FT                   /product="3'-adenylyltransferase"
FT                   /EC_number="2.7.7.47"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: bur:Bcep18194_B2105 streptomycin
FT                   3''-adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92701"
FT                   /db_xref="GOA:B1K347"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:B1K347"
FT                   /protein_id="ACA92701.1"
FT                   /translation="MSRICIPIAERRASFARRMSVSVRLGKTLGIVGESGSGKSTRAMA
FT                   LPGCCFFALRRARIARFAVVTDFIPHDIAAQLAAARAVIERHLGATLQAVHLFGSALDG
FT                   GLKPSSDIDWLVTVAVRPDEAVRHALMSDLLGASAPPGCSGGMRALEVTVVAHGDGVPW
FT                   RHPARRELQFGEWLRGDLEAGIVEPPLVDHDLAILLTKARQHGVALVGPPADVLFEPVP
FT                   ARDFVAALRATVAQWEAEPDWRGDACNIVLALARIWYSAATGAIAPKDVAATWVLERLP
FT                   DVHRPIVAAARAAYLDGEAGAAILLGAPLAEFIGYARRTVESMLSA"
     atgtcgcgca tctgcatccc catcgccgag cggcgagctt cgttcgcgcg acgcatgtcg        60
     gtgtcggtgc ggctgggcaa aacgctcggc atcgtcggcg aatcgggatc ggggaagtcg       120
     acgcgcgcga tggcgctgcc cgggtgttgt ttcttcgcgc tccgtcgggc gcgcatcgcc       180
     aggtttgccg tcgtgaccga cttcatcccc cacgacatcg ccgcacagct cgccgccgcg       240
     cgcgccgtga tcgaacggca cctcggtgcg acgctgcaag cggtccatct tttcggatcg       300
     gcgctcgacg gcggcttgaa accgagcagc gacatcgatt ggctggtgac ggtcgcggtg       360
     cgcccggacg aagcggtgcg acacgcactg atgtcggacc tgctcggcgc gtcggcgccg       420
     cccggttgca gcggcggcat gcgcgcgctg gaggtcaccg tcgtcgcgca cggcgacggg       480
     gtgccgtggc gtcatccggc gcgacgcgag ctgcagttcg gcgaatggct gcgcggcgat       540
     ctggaagctg gcatcgtcga gccgccgctg gtcgatcacg atctggccat cctgctgacg       600
     aaggcgcgac agcacggtgt cgcactggtc gggccgcctg ccgacgtgct gttcgagccg       660
     gtgcccgcgc gcgacttcgt cgccgcgctg cgcgcgaccg ttgcgcagtg ggaagccgaa       720
     ccggactggc gtggcgacgc gtgcaacatc gtgctcgcgc tcgcacgcat ctggtacagc       780
     gccgcgaccg gcgcgatcgc gccgaaggac gtcgccgcga cgtgggtgct ggagcgcctg       840
     ccggacgtgc accggccgat cgtagccgct gcgcgagcgg cctatctcga tggcgaagca       900
     ggcgcggcaa tcctgttggg cgcaccgctg gccgaattca tcggctacgc gcggcggacg       960
     gtcgagtcga tgctgtcggc gtag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page