(data stored in ACNUC1104 zone)

EMBL: CP000959.PE368

CP000959.PE368       Location/Qualifiers
FT   CDS_pept        complement(437211..439427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92709"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:B1K355"
FT                   /protein_id="ACA92709.1"
FT                   /translation="MRRLILVGMTVCAVLLTSAAPAETVLPATTSWIGNTFGYGDGTWT
FT                   QIDIRAIAVTPEGKVYTNAPWDESGAEASVYQDGKMLGFAGGTHGWGNLGGSAIAVNGK
FT                   YAYVAIGVGNERGHLQSPGIWPDKGKQWFGISRRTIGDMKQPAPFRAAPQVAPGGRADS
FT                   GRARMAASFMMMNEVPAPARSEVGEAKAEVGGLAADDKTLFATNPSRDVVDVYDAETMQ
FT                   QKGTWSAHEPGRIALAGDGTLWLLTDTLGGPAHLVHVRADGRKLDDAPALPEGTDAVDV
FT                   AVDAKGRVLVADNGSRQQILIFSKGGNGYAPSGTLGERGGIFAGPVPGRPGPQRFNGLT
FT                   GVGVDRAGNIYVSMNGIGPRHDTIGAGLGAVLESYTPDGKLRWQVQGLLFVDGAWLDPA
FT                   RPNSVYTGNKRFELDLSKPPGQDWKYVGFLSNRFKYPDDPVFHTDQYPGMPIARRVDGR
FT                   TFLYLTDMYADHLKIYRFDAKRDGEVAIPSGLIAGRARPVDKVPNKPPGGDWLWRDANG
FT                   NGRIDADESEINTTGKAKAGGWGWWVDTKGDIWRTSDVRGIHRFQYGGVDKAGNPIYSY
FT                   DKVTTYPMPQPFTQLRRAIYEPQTDTLYVTGYTADAPPQPGINKEVGRVLIRFDKWSTG
FT                   SPVARYQVALPWKLDAKPIFDLIGITVEGRYIFTVEPVGKIHVYDKETGKEVGVMSPGA
FT                   EVGKASGWVDVPFGISAFRRENGEYLVFVEEDARGKVLMYRWKP"
     ttgcgacgtc tgattctggt tggcatgacg gtatgcgcgg tgctgctgac gagcgccgcg        60
     ccggccgaaa cggtgttgcc cgcgacgacc tcgtggatcg gcaacacgtt cggctatggc       120
     gatggcacat ggacgcagat cgacatccgc gcgatcgcgg tgacgcccga gggcaaggtg       180
     tatacgaatg caccgtggga cgagagcggc gccgaggcga gcgtctacca ggacgggaag       240
     atgctcggct tcgccggcgg cacgcacggc tggggcaatc tcggcggcag cgcgatcgcg       300
     gtgaacggca agtacgcgta tgtcgcgatc ggcgtcggca acgagcgcgg ccacctgcag       360
     tcgcccggca tctggccgga caagggcaag caatggttcg gcatctcgcg gcgcacgatc       420
     ggcgacatga agcagcccgc gccgtttcgc gcggcgccgc aggtcgcgcc gggcgggcgc       480
     gccgatagcg gccgcgcacg gatggccgcc agcttcatga tgatgaacga ggtgccggcg       540
     cccgcgcgct cggaagtggg cgaggcgaag gcggaagtgg gcggcctcgc ggccgacgac       600
     aagacgctgt tcgcgaccaa tccgtcgcgc gacgtggtgg atgtgtacga cgcggagacg       660
     atgcagcaga agggcacgtg gagcgcgcac gaaccgggcc gcatcgcgct cgccggtgac       720
     ggcacgctgt ggctgctgac cgatacgctg ggtgggcccg cgcatctcgt gcacgtgcgg       780
     gccgacggcc gcaagctaga cgacgcgccg gcgctgccgg aaggcaccga cgcggtggac       840
     gtggcggtcg acgcgaaagg acgcgtgctc gtcgcggaca acgggtcgcg ccagcagatc       900
     ctgatcttct cgaaaggcgg caacggctat gcgccgtcgg gcacgctcgg cgaacgcggc       960
     ggcatcttcg cgggcccggt gccgggccgg ccggggccgc agcgtttcaa cgggctgacc      1020
     ggcgtcggcg tcgaccgcgc gggcaacatc tacgtatcga tgaacgggat cgggccgcgc      1080
     cacgacacga tcggcgcggg gctcggcgcg gtgctggaga gctacacgcc ggacggcaag      1140
     ctgcgctggc aggtgcaggg gctgctgttc gtcgacggcg cgtggctcga ccccgcgcgg      1200
     ccgaacagcg tgtacacggg caacaagcgc ttcgagctcg acctgtcgaa gccgccgggc      1260
     caggactgga aatacgtcgg cttcctgtcg aaccgcttca agtatccgga cgacccggtg      1320
     ttccatacgg accagtatcc gggcatgccg atcgcgcggc gcgtcgacgg gcgcacgttc      1380
     ctgtacctga ccgacatgta cgccgatcac ctgaagatct accgcttcga cgcgaagcgc      1440
     gacggcgagg tcgcgattcc gtcgggcctg atcgcgggcc gcgcgcggcc ggtcgacaag      1500
     gtgccgaaca agccgccggg cggcgactgg ctgtggcgcg acgcgaacgg caacggccgg      1560
     atcgatgccg acgagtccga gatcaacacg acgggcaagg cgaaggcggg cggctggggc      1620
     tggtgggtcg acacgaaggg cgacatctgg cgcacgagcg acgtgcgcgg catccaccgc      1680
     ttccagtacg gcggcgtcga caaggccggc aacccgatct attcgtacga caaggtcacg      1740
     acctacccga tgccgcagcc gttcacgcag ctgcgccgcg cgatctacga gccgcagacc      1800
     gacacgctgt acgtgaccgg ctacacggcg gatgcgccgc cgcagccggg tatcaacaag      1860
     gaagtggggc gcgtgctgat ccgcttcgac aagtggtcga cgggctcgcc agtcgcgcgc      1920
     taccaggtgg cgctgccgtg gaagctcgat gcgaagccga tcttcgacct gatcgggatc      1980
     acggtcgagg ggcgctacat cttcacggtg gagccggtcg gcaagatcca cgtgtacgac      2040
     aaggaaaccg gcaaggaagt cggcgtgatg agcccgggcg cggaggtcgg caaggcgtcg      2100
     ggctgggtcg acgtgccgtt cggcatcagt gcgttccggc gcgagaacgg cgagtacctg      2160
     gtgttcgtcg aggaagacgc gcgcggcaag gtgctcatgt accgctggaa accttaa         2217
//

If you have problems or comments...

PBIL Back to PBIL home page