(data stored in ACNUC1104 zone)

EMBL: CP000959.PE373

CP000959.PE373       Location/Qualifiers
FT   CDS_pept        complement(444928..446118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3562"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: bmu:Bmul_4614 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92714"
FT                   /db_xref="GOA:B1K360"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1K360"
FT                   /protein_id="ACA92714.1"
FT                   /translation="MDDSLNFDTLAVRAGTLRSDFNEHSEALFLTSSFCFSSAADAAER
FT                   FANSEDYFTYSRFTNPTVTMFQERLAALEGGEACIATASGMAAIMSVVMSALQAGDHLV
FT                   SSRSLFGSTLGMFSQIFSKFGITTTFVDPTDLNAWQEAVRPETKMFFLETPSNPLTELA
FT                   DIEAIGKIAKAANALFVVDNCFCSPVLQQPLKLGADVVMHSATKFLDGQGRVLGGALVG
FT                   SKEFIMGKVFPFVRSAGPTLSAFNAWVLLKGMETLSLRVEKQSANALEIARWLDSHPAV
FT                   ARVFYPGLESHPQHELAKRQQKAGGAIVSFELKGDTPEQQRANAWRVIDGTKLVSITGN
FT                   LGDTRTTITHPATTTHGRITPEARAAAGITEGLIRLAVGLEHAGDIRNDLARGLDG"
     atggacgact ccctcaactt cgacacgctt gccgtgcgcg cgggcacgct gcgcagcgac        60
     ttcaacgagc attcggaagc gctgttcctc acgtcgagct tctgcttctc gagcgcggcc       120
     gacgcggccg agcgcttcgc gaattcggaa gactatttca cctattcgcg cttcacgaat       180
     ccgaccgtca ccatgttcca ggagcgtctc gcggcgctcg agggcggcga ggcgtgcatc       240
     gcgacggcgt cgggcatggc cgcgatcatg tcggtcgtga tgtccgcgct gcaggcggga       300
     gaccacctcg tcagctcgcg cagcctgttc ggctcgacgc tcgggatgtt ctcgcagatc       360
     ttcagcaagt tcgggatcac gacgaccttc gtcgacccga ccgacctgaa cgcgtggcag       420
     gaagcggtgc ggccggaaac gaagatgttc ttcctcgaga cgccgtcgaa cccgctgacc       480
     gagctcgccg acatcgaggc catcggcaag atcgcgaagg cggcgaacgc gctgttcgtc       540
     gtcgacaact gtttctgcag cccggtactg cagcagccgc tgaagctcgg cgcggatgtc       600
     gtgatgcact ccgcgacgaa attcctcgac gggcagggcc gcgtactcgg cggcgcgctg       660
     gtcggctcga aggaattcat catgggcaag gtgttcccgt ttgtgcgcag cgcaggcccg       720
     acgctgtcgg cgttcaacgc gtgggtgctg ctgaagggga tggagacgct gtcgctgcgc       780
     gtcgagaagc agtcggcgaa cgcgctggag atcgcgcgct ggctcgactc gcatccggcg       840
     gtggcgcgcg tgttctatcc ggggctcgaa tcgcatccgc agcatgaact cgcgaagcgt       900
     cagcagaagg cgggtggtgc gatcgtgtcg ttcgagctga agggcgacac gcccgagcag       960
     cagcgcgcga acgcatggcg cgtgatcgac ggcacgaagc tggtgtcgat caccggcaac      1020
     ctcggcgaca cgcgtacgac gatcacgcat ccggccacca cgacgcacgg ccggattacg      1080
     ccggaagcgc gtgcggcggc ggggatcacc gaggggttga ttcgcttggc ggttggcctg      1140
     gagcatgcgg gcgacattcg caacgatctg gcgcgtggtc tggacggctg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page