(data stored in ACNUC1104 zone)

EMBL: CP000959.PE375

CP000959.PE375       Location/Qualifiers
FT   CDS_pept        complement(447963..448457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3564"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; KEGG:
FT                   bur:Bcep18194_B2119 colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92716"
FT                   /db_xref="GOA:B1K362"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B1K362"
FT                   /protein_id="ACA92716.1"
FT                   /translation="MLTAFDYAVLAVIVLSALRGAWRGFVSEIFGLIGWIAAIVIASRY
FT                   VGLVVPYIPANWPGGALTQWVIAFALLVIGVVLVAGVANALLSRIAQASGLGGVDRSLG
FT                   MMFGLVRGCVLVVLLVAAAGLTELPKQDFWRNALLRPFAEQGVHELKQLLPDGMAQYVR
FT                   V"
     atgctgacgg ctttcgacta cgctgtattg gcggtgatcg tgttgtcggc gctgcgcggc        60
     gcgtggcgcg gcttcgtgtc cgagattttc gggctgatcg gctggatcgc ggcgatcgtg       120
     atcgcgagcc gctacgtcgg gctggtcgtg ccgtacattc cggcgaactg gccgggcggc       180
     gcgctgacgc agtgggtgat cgccttcgcg ttgctcgtga tcggcgtcgt gctggtcgcc       240
     ggcgtggcga acgcgctgct gtcgcggatc gcgcaggcga gcggcctggg cggcgtcgac       300
     cgctcgctgg gcatgatgtt cgggctcgtc cgcggctgcg tgctggtggt gctgctggtc       360
     gcggcggccg ggctgaccga actgcccaaa caggatttct ggcgcaatgc gctcttgcgt       420
     ccttttgccg aacagggtgt gcacgagctg aagcagctct tgcccgacgg catggcccag       480
     tacgtacgcg tgtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page