(data stored in ACNUC1104 zone)

EMBL: CP000959.PE376

CP000959.PE376       Location/Qualifiers
FT   CDS_pept        complement(448465..449301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3565"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   bur:Bcep18194_B2120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92717"
FT                   /db_xref="GOA:B1K363"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B1K363"
FT                   /protein_id="ACA92717.1"
FT                   /translation="MGIFSFGKKDDDAPPRRGGRTGASRNVRTERTERVERRSRRTERP
FT                   ESDALLLDPTLPEKQRARRRLVGAIALVVAAVIVLPMVLDSHPKPVTDDIAIDIPNRPA
FT                   HQAVAPRDDDVSDVQAGVAHDEPPASDTAVAAALAPAPKDAAKPAAKPDTTTTASVTPP
FT                   KPAPKPAAPAAKPAAPKPAPATVANDGAASPDSGDASSPASPAGARFAVQLGSFKDDAT
FT                   ARSWATKLKSAGVPAYVEHRKQADGSTATLLRAGPFADRSAASAAIAKVREAGLTQ"
     atgggaattt tctcgttcgg caagaaagac gacgacgcgc ccccgcggcg cggcggtcgc        60
     accggggcct cccggaacgt gcgcacggag cgcactgaac gcgtcgagcg ccgctcgcgc       120
     cgcaccgagc gtccggaatc ggatgcactg ctcctcgatc cgacccttcc agaaaagcaa       180
     cgcgcgcgcc gtcgccttgt cggcgcgatc gcgctcgtcg tggccgcggt gatcgtgctg       240
     ccgatggtgc tcgattcgca cccgaagccg gtcacggacg acatcgcgat cgacatcccg       300
     aaccgccccg cgcaccaggc ggtcgcgccg cgcgacgacg atgtgtccga cgtgcaggcg       360
     ggtgtcgcgc acgacgaacc gccggcctcc gatacggccg ttgcggccgc actggcgccc       420
     gcgccgaagg atgccgcgaa gccggccgcg aaacccgata cgaccaccac ggctagcgtg       480
     acgccgccga agcccgcgcc gaagccggct gcgcccgccg caaaaccggc cgcgccgaag       540
     cctgcgcccg caaccgtcgc gaatgacggc gccgcgagcc cggacagcgg cgacgcatcg       600
     tcgccggcat cgccggccgg tgcgcgcttc gcggtgcagc tcggctcgtt caaggacgac       660
     gcgacggccc gttcgtgggc gaccaagttg aaatcggcgg gtgtgcccgc atatgtcgag       720
     catcgcaagc aggcagacgg cagcacggct acactgttgc gggccggccc gttcgcggat       780
     cgttcggcgg cttccgccgc gatcgcgaag gtgcgcgaag ccggtctgac gcagtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page