(data stored in ACNUC1104 zone)

EMBL: CP000959.PE378

CP000959.PE378       Location/Qualifiers
FT   CDS_pept        complement(450742..451614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3567"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; KEGG: bam:Bamb_3351 acetyl-CoA
FT                   carboxylase, carboxyl transferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92719"
FT                   /db_xref="GOA:B1K365"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:B1K365"
FT                   /protein_id="ACA92719.1"
FT                   /translation="MSWLDKLLPPKIKQTDPKSRKGIPEGLWVKCPSCEAVLYRNDVDA
FT                   NLHVCPKCDHHMRIGARERLDGLLDPEGRYEIGQEIVPVDSLKFKDSRKYPDRLKEAMD
FT                   ETGETDAMVVMGGAIHTLPVVAACFEFSFMGGSMGSVVGERFARGAQNALEQHVPFICF
FT                   TASGGARMQESLLSLMQMAKTTAMLTKLAEAKLPFISVLTDPTMGGVSASFAFLGDVVI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLKTGAIDMIVDRRKMRDEIAQLLALL
FT                   QRQPADALA"
     atgagctggc tcgacaaact gttgccgccg aagatcaagc agaccgaccc gaaaagccgc        60
     aagggcattc cggaaggcct gtgggtcaag tgcccgtcct gcgaggccgt tctctatcgc       120
     aacgacgtgg acgcgaacct gcacgtgtgc ccgaagtgcg atcaccacat gcgcatcggc       180
     gcgcgtgagc gcctcgacgg gctgctcgat ccggaaggcc gctatgaaat cggccaggaa       240
     atcgtgccgg tcgactcgct gaagttcaag gacagccgca agtaccccga tcgtctgaag       300
     gaagcgatgg acgaaaccgg cgagaccgac gcgatggtcg tgatgggcgg cgcgatccac       360
     acgctgcccg tcgtcgcggc ctgcttcgag ttctcgttca tgggcggctc gatgggttcg       420
     gtcgtcggcg aacgtttcgc gcgcggtgcg cagaacgcgc tggaacagca cgtaccgttc       480
     atctgcttca ccgcatcggg cggcgcgcgg atgcaggaaa gcctgctgtc gctgatgcag       540
     atggccaaga ccaccgcgat gctgaccaag ctggccgaag ccaagctgcc gttcatctcg       600
     gtgctgaccg acccgacgat gggcggcgtg tcggcgagct tcgcgttcct cggcgacgtc       660
     gtgatcgctg agccgaaggc gctgatcggc ttcgccggcc cgcgcgtgat cgagcagacg       720
     gtccgcgaga agctgccgga aggcttccag cgcgccgaat tcctgctgaa gacgggcgcg       780
     atcgacatga tcgtcgaccg tcgcaagatg cgcgacgaga tcgcgcagtt gctcgcactg       840
     ctgcagcgac agccggccga cgcgctggct tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page