(data stored in ACNUC1104 zone)

EMBL: CP000959.PE379

CP000959.PE379       Location/Qualifiers
FT   CDS_pept        complement(451679..452494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3568"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: bur:Bcep18194_B2123 tryptophan synthase
FT                   subunit alpha; TIGRFAM: tryptophan synthase, alpha subunit;
FT                   PFAM: tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92720"
FT                   /db_xref="GOA:B1K366"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1K366"
FT                   /protein_id="ACA92720.1"
FT                   /translation="MNRIKQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAAGGA
FT                   DVIELGVPFSDPMADGPVIQRSSERALARGVTLKSVLADVKRFRETDPKTPVVLMGYAN
FT                   PIERMGVDAFAAEAHAAGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERI
FT                   ADVGKIASGYVYYVSLKGVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARA
FT                   VAEVSDAVVIGSRLVQLLESAAPEGAAAALKTFIAELRAALDGAGNTAR"
     atgaatcgta ttaagcagac cttcgccgcg ctcgccgaac aaggccgtaa gggcctgatc        60
     ccgttcatca cggccggcga ccctgatccc gcgaaaaccg tcgaattcat gcacgcgctc       120
     gccgccggcg gcgcggacgt gatcgaactc ggcgtgccgt tctcggaccc gatggccgac       180
     ggccccgtga tccagcgctc gtcggaacgc gcgctcgcgc gcggcgtcac gttgaagagc       240
     gtgctcgccg acgtgaagcg ttttcgcgaa accgacccca aaacccccgt cgtgctgatg       300
     ggctatgcga acccgatcga acggatgggc gtcgacgcat tcgcggccga agcccacgcg       360
     gccggcgtcg acggcgtgct ggtggtcgac tatccgccgg aagaggcggg cgtattcgcc       420
     gagaaaatgc gtgccgcgca gatcgatccg atcttcctgc tcgcgcccac gtcgaccgac       480
     gaacgcatcg ccgacgtcgg caagatcgcg agcggctacg tgtattacgt gtcgctcaag       540
     ggcgtgaccg gcgcgggaaa tctggatgtt tcgagcattg caggtaaaat cccggccatc       600
     aagtcgcgcg tgccggttcc ggtgggcgtc ggcttcggta tccgcgacgc cgaaacggcg       660
     cgcgcggtgg ccgaagtgtc ggacgccgtc gtgatcggca gccgcctcgt gcagctgctc       720
     gagagcgccg cgccggaagg tgccgccgcc gcgttgaaga ctttcatcgc cgagctgcgt       780
     gctgcgctgg acggtgcggg caacacggcg cgataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page