(data stored in ACNUC1104 zone)

EMBL: CP000959.PE38

CP000959.PE38        Location/Qualifiers
FT   CDS_pept        43676..44419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3223"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   bur:Bcep18194_B1725 cyclic nucleotide-binding domain
FT                   (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92379"
FT                   /db_xref="GOA:B1K899"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K899"
FT                   /protein_id="ACA92379.1"
FT                   /translation="MHDHPDAAAAPADTPPAPGPLPPLATLFGQCAWFRTLAPEHQARV
FT                   LAESHVAQCEAGDVIAHRLAPSEYWIGVHQGLLKLAIFNVSGRGCTFSGVPSGGWFGEG
FT                   SVIKRELRKYEVVAIQRSTVLFVPVDTFHALLDTSLPFTRFVIHQLNNRMGEFIASIQN
FT                   SRLLDVDARVAQALAQLFNPALYPDTGPSLSISQEELGMLVGVSRQRINQALQQLEKLG
FT                   ALRLAYNQIEVVDLDALARFGMEQL"
     atgcacgacc atcccgacgc ggccgccgcc ccggccgaca cgcctcccgc accgggcccg        60
     ctgccgccgc tcgcgacgct gttcggccag tgcgcgtggt tccgcacgct ggcgcccgaa       120
     caccaggcgc gcgtgctggc cgagtcgcac gtcgcgcagt gcgaagcggg cgacgtgatc       180
     gcgcaccggc tcgcgccgtc cgaatactgg atcggcgtcc atcaggggtt gctgaagctc       240
     gcgatcttca acgtgtcggg gcgcggctgc acgttctccg gcgtgccgtc cggcggctgg       300
     ttcggcgaag gcagcgtgat caagcgcgag ctgcgcaagt acgaggtcgt cgcgatccag       360
     cgctcgaccg tgctgttcgt gccggtcgac acgttccatg cgctgctcga cacgagcctg       420
     ccgttcacgc gcttcgtgat tcatcagttg aacaaccgga tgggcgaatt catcgcgtcg       480
     atccagaaca gccggctgct cgacgtcgac gcgcgcgtcg cgcaggcgct cgcgcagctc       540
     ttcaatcccg cgctgtaccc ggacaccggc ccgtcgctgt cgatctcgca ggaggaactg       600
     gggatgctcg tcggcgtgtc gcgccagcgg atcaaccagg cgctgcagca gctcgagaag       660
     ctcggcgcgc tgcggctcgc gtacaaccag atcgaggtcg tcgatctcga cgcgctcgcg       720
     cgcttcggca tggagcagct gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page