(data stored in ACNUC1104 zone)

EMBL: CP000959.PE381

CP000959.PE381       Location/Qualifiers
FT   CDS_pept        complement(453444..454637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3570"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: bur:Bcep18194_B2125 tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92722"
FT                   /db_xref="GOA:B1K368"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1K368"
FT                   /protein_id="ACA92722.1"
FT                   /translation="MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFQNDPDFVA
FT                   EFERELKYFVGRPSPIYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRM
FT                   GKKRVIAETGAGQHGVATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVE
FT                   SGSRTLKDALNEAMRDWVTNIESTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPEL
FT                   AGRQPDAVIACVGGGSNAMGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGV
FT                   LHGNRTYLLQDDNGQIIETHSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDAEALKAFH
FT                   DCCRIEGIIPALESSHAIAYGVKLAPTLPKDKLLLVNLSGRGDKDMHTVAERSGIEL"
     atgtacaacc ttcctgatga tcgcggccat ttcggcccgt atggcggcgt gttcgtcgcc        60
     gagacgctga ttcacgcgct ggacgaactg cgcgcggcgt atgaaaagtt ccagaacgat       120
     cccgacttcg tcgccgaatt cgagcgcgag ctgaagtatt tcgtcggccg cccgtcgccg       180
     atctatcacg cgcagcgctg gagcgagatg ctcggcggcg cgcagatcta cctgaagcgc       240
     gaagacctga accacacggg tgcgcacaag atcaacaacg tgatcggcca ggcgctgctc       300
     gcgaagcgca tgggcaagaa gcgcgtgatc gcggaaacgg gcgccggcca gcacggcgtc       360
     gcgaccgcga cgatctgcgc gcgcttcggg atggagtgcg tcgtctacat gggctcggag       420
     gacgtgcgcc ggcaggccgc gaacgtctac cggatgaagc tgctgggcgc gaccgtcgtg       480
     ccggtcgaat cgggttcgcg cacgctgaag gacgcgctga acgaagcgat gcgcgactgg       540
     gtcacgaata tcgaaagcac gttctacatc atcggcacgg tcgcgggccc gcacccgtac       600
     ccgatgatgg tgcgcgactt ccagcgcgtg atcggtgacg agtgcaaggt gcagatgccc       660
     gagctcgccg gccgccagcc ggacgcggtg atcgcgtgcg tcggcggcgg gtcgaacgcg       720
     atgggcatct tctatccgta catcgacgat acctcggtgc aactgatcgg cgtcgaagcg       780
     gccggcgacg gcctcgacac gggccatcac gctgcctcgc tgatcgccgg cagccccggc       840
     gtgctgcacg gcaaccgcac gtacctgctg caggacgaca acggccagat catcgagacg       900
     cattcggtgt cggcgggcct cgattatccg ggcgtcggtc ccgagcacgc atggctgaag       960
     gacagcggcc gcgcgcagta cgtgccgatc accgacgcgg aagcgttgaa ggcgtttcac      1020
     gactgctgcc ggatcgaggg gatcattccc gcgctcgagt cgagccacgc gatcgcgtac      1080
     ggcgtgaagc tcgcgccgac gttgccgaag gacaagctcc tgctcgtcaa cctgtcgggc      1140
     cgcggcgaca aggacatgca cacggtcgcc gagcgatcgg gcatcgagct ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page