(data stored in ACNUC1104 zone)

EMBL: CP000959.PE384

CP000959.PE384       Location/Qualifiers
FT   CDS_pept        complement(456202..458334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92725"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:B1K371"
FT                   /protein_id="ACA92725.1"
FT                   /translation="MSRIFLFPRQSRLSRAVRGALAILALGVAASAWAVGTGELPASAA
FT                   AAAAPLTVTVQPGQSLNDIAKAATQSHDPAVLARAGRALFDANPQAFMKRDASRLKVGA
FT                   TLTVPALDATGAALVPAGASAASGAAAASAPAAASGGAAIAQHGASAPHPGSTVQPAPV
FT                   APAVHAAPVSGASVATATAAGALASSGASASIGASAAYGASAVESTQPATSTAGASGPH
FT                   VWSGAIQSAPSSASEAAGQAVPGSPVSGVHEPAGAAPAVTASQPRPSSLQQLLALKNRV
FT                   LMELQKHGIGKPATTTGVVPAPAPAAPRPAANDAGASAAASTADEAASGVAASAPQPAS
FT                   ASVQPVAPVATPARRTEQIDWRPAAAAGAAVIVLAAGFAWRKRRKGRRADDAGTVATAT
FT                   AAAGGGAVAAEAEAASSVERELPITPEMPVARDAASDLNLAAATAAAAETIEPPAADTS
FT                   PAPEVTAPRDESPELPPAHAAEPVANEATPVPVEAPHDAEPAEKTTAADQPADPTAASA
FT                   APATTEAQHASLMQNAISALNSLDMPLPPRTADEPSSTAEEPSARAVQSDVDKIATNGQ
FT                   SAQHPPTGASEPAPEHPADQDEEFDWDPDAATPAGQAGSPPVTTSLPPLGGAQFGALKL
FT                   DFDLDLPSTPGAALPALTADELARIARNKLDLAAEYVELGDLSGARTLLQEVIDANDAA
FT                   TRDDARALLAKLADEA"
     atgtcccgaa ttttcttgtt tccgcgtcag tctcgcctgt cgcgcgccgt gcgtggcgcg        60
     ctggcgatcc tggcgctcgg cgtagccgca tcggcgtggg cagtcggtac cggcgaattg       120
     ccggcgtccg ccgccgccgc cgccgctccg cttaccgtga cggtccagcc gggccagtcg       180
     ctgaacgaca tcgcgaaagc ggccacgcaa tcgcatgatc cggccgtgct cgcacgcgct       240
     ggccgtgcgt tgttcgatgc caatccgcag gcgttcatga aacgcgacgc gagccgcctg       300
     aaagtcggcg cgacgctgac cgtgcccgcg ctcgacgcga ccggcgcggc gctcgtgccg       360
     gccggcgcat ccgctgcctc cggtgcggcg gctgcttccg cgcccgccgc cgcatcgggc       420
     ggagcggcga tcgcgcagca tggcgcatcc gcgccgcatc ccggctcgac cgtgcaacct       480
     gcgccggtgg cgccggccgt gcatgcggcg ccggtgagcg gggcgagtgt cgcgacggcg       540
     acggcggcgg gggcgttggc ttcgagcggt gcttcggctt cgatcggcgc gtcggccgca       600
     tatggcgcgt cggctgtcga aagcacgcag ccggcgacgt ccacggccgg ggcaagcggc       660
     ccgcacgtgt ggagcggtgc gatccagtcg gcgccgtcgt ccgcgagcga ggccgcgggg       720
     caggcggtgc cgggtagccc ggtttccggc gtgcatgaac cggccggcgc ggcgcccgcc       780
     gtgactgcgt cgcagccgcg gccgtcgagc ctgcagcaat tgctggcgtt gaagaatcgc       840
     gtgctgatgg agttgcagaa gcacggcatc ggcaagccgg cgacgacgac cggcgtcgtg       900
     cctgctccgg cgcccgccgc gccgcgcccg gccgcgaatg acgcgggtgc atcggccgct       960
     gcatcgacgg cggacgaagc cgcatcgggt gtggcggcga gtgcgccgca accggcctcg      1020
     gcttccgtgc aaccggtcgc gcccgtcgcg acaccggcac gtcgtaccga acagatcgac      1080
     tggcgcccgg ccgccgcggc cggcgctgcc gtgatcgtgc ttgcggccgg cttcgcatgg      1140
     cgcaagcgcc ggaagggtcg ccgcgctgac gatgcgggta ccgttgcgac cgcgaccgcg      1200
     gccgcagggg gcggtgccgt ggctgcggaa gccgaagccg cgtcgtctgt cgaacgagaa      1260
     ctgccgatca cgcccgagat gccggtcgca cgcgatgcgg cgtccgacct gaacctcgcc      1320
     gcggcgactg ccgctgcggc agagacgatc gagccgcccg cagcggacac atcgcccgcg      1380
     cctgaagtga cggcgccgcg tgacgagtcg ccggaattgc cgcctgctca cgctgcggag      1440
     ccggtcgcga acgaggcgac tccggttccg gtcgaggctc cgcacgacgc agaaccggcg      1500
     gaaaaaacca ccgcagcgga ccagccagcc gacccgaccg ccgcatccgc cgcacctgcg      1560
     acgaccgaag cgcagcacgc gtcgctgatg cagaacgcga tcagcgcgct caacagtctc      1620
     gacatgccgt tgccgccgcg gacggcggac gagccatcgt cgacggcgga ggaaccgtct      1680
     gcgcgggcag tgcagtccga tgtcgataaa atcgcaacta acggtcaatc cgcgcagcac      1740
     ccgccaacgg gcgcgagtga accggcaccg gaacatcccg ccgaccagga cgaggagttc      1800
     gattgggacc cggacgcagc gacgcccgcc ggccaagctg gcagcccgcc cgtgacgaca      1860
     tcgctgcccc cgctcggcgg cgcgcagttc ggcgcgctga agctcgactt cgatctcgac      1920
     ctgccgtcca cgccgggcgc cgcgctgccc gcgctcaccg cggacgagct cgcgcgcatc      1980
     gcccgcaaca agctcgacct cgcggccgaa tacgtcgaac tgggcgacct gtccggcgcg      2040
     cggacgctgc tgcaggaagt gatcgacgcg aacgacgccg cgactcgcga cgatgcacgc      2100
     gcgctgctcg cgaaactggc ggacgaggcg tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page