(data stored in ACNUC1104 zone)

EMBL: CP000959.PE385

CP000959.PE385       Location/Qualifiers
FT   CDS_pept        459146..460390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3574"
FT                   /product="flagellar basal body FlaE domain protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body FlaE domain protein; KEGG: bur:Bcep18194_B2129
FT                   flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92726"
FT                   /db_xref="GOA:B1K372"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B1K372"
FT                   /protein_id="ACA92726.1"
FT                   /translation="MGYQQGLSGLAGASSNLDVIGNNIANANTVGFKQGRANFADMYAN
FT                   SVATSVNTQIGIGTRLASVQQNFGQGTINSTKSSLDVAINGNGFFQMSSNGVTTYSRDG
FT                   TFHRDKNGAIVDAQGRNLMGYAAGAGGVINTAQTVPLQAPTSNIAPRATSKITGQFNLN
FT                   AQDKVPAKTPFNATDNTTYNYNSSIQVYDTLGGSQQVTMYFAKNAAGTWQAYAGVQGQT
FT                   PTNLGTVTFDASGRLSSTTSAATGQPTPSLGQFAFSIPNTTGGANPQNLTLDLGGTTQY
FT                   GGKDGVNNLAQDGFASGTLTTFSIGTDGKLTGNYSNGQSAVLGLIALANFNNPNGLVNI
FT                   GGNQYAETAASGVPQISAPGSTNHGTLQGSALENSNVNLTTELVNLITAQRNYQANAQT
FT                   IKTQQAVDQTLLNLR"
     atgggctatc agcagggttt gagcgggttg gccggggcgt cgagcaatct cgacgtgatc        60
     ggcaacaaca tcgcgaacgc aaacacggtc ggcttcaagc agggacgcgc gaacttcgcc       120
     gacatgtacg cgaattcggt cgcgacgtcg gtcaacacgc agatcggcat cggcacgcgg       180
     ctcgcgtcgg tgcagcagaa tttcggccag gggacgatca attcgacgaa gtcgtcgctc       240
     gacgtcgcga tcaacggcaa cggcttcttc cagatgtcga gcaacggcgt gaccacgtac       300
     tcgcgcgacg gcacgttcca ccgcgacaag aacggcgcga tcgtcgacgc gcaaggccgc       360
     aacctgatgg gctatgcggc aggcgccggc ggcgtgatca acaccgcgca gaccgtgccg       420
     ctgcaggcgc cgaccagcaa catcgcaccg cgcgcgacga gcaagatcac cggccagttc       480
     aacctgaacg cgcaagacaa agtgccggcc aagacgccgt tcaacgcgac cgacaacacg       540
     acgtacaact acaactcgtc gatccaggtc tacgacacgc tcggcggctc gcaacaggtc       600
     acgatgtact tcgcgaagaa cgcggccggc acgtggcagg cctacgcggg cgtgcagggc       660
     cagacgccga cgaatctcgg caccgtcacg ttcgatgcat cgggccggct cagctcgacg       720
     acgtcagccg cgaccggcca gccgacgcca agcctcggcc agttcgcgtt ctcgatcccg       780
     aacacgacgg gcggcgccaa tccgcagaac ctgacgctcg acctcggcgg cacgacgcag       840
     tacggcggca aggacggcgt gaacaatctc gcgcaggacg gcttcgcgag cggcacgctg       900
     acgacgttct cgatcggcac cgacggcaag ctcaccggca actattcgaa cggccagagc       960
     gcggtgctcg gcctgatcgc gctggcgaac ttcaacaacc cgaacgggct cgtgaacatc      1020
     ggcggcaacc agtatgcgga aacggccgcg tcgggcgtgc cgcagatctc agctccgggc      1080
     agcacgaacc acggcacgct gcagggtagc gcgctcgaaa actcgaacgt caacctgacg      1140
     accgagctcg tgaacctgat caccgcgcag cgcaattacc aggcgaatgc gcagacgatc      1200
     aagacccagc aggccgtcga ccagacgctg ctgaacctgc gctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page