(data stored in ACNUC1104 zone)

EMBL: CP000959.PE392

CP000959.PE392       Location/Qualifiers
FT   CDS_pept        complement(466812..467369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3581"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vei:Veis_1032
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92733"
FT                   /db_xref="GOA:B1K379"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1K379"
FT                   /protein_id="ACA92733.1"
FT                   /translation="MDDALDGFIRVFRERGYHATSIGDLSRETGLTAGSLYKAFADKNA
FT                   IFVAALNRYIDRRVSELNVILADEKSGRDKVRALLRFYADVSHGDEGRKGCLVVAGAIV
FT                   LSTLDSEIAGIVHKSMQRIERLLRDLIKQGQADGSVDAALNAQAASSCLFAMVQGLRVV
FT                   GKLGQSRSDMSMLVDEAMRLLD"
     atggatgacg cgctggacgg cttcatccgc gtctttcgcg agcgtggcta tcatgcgact        60
     tctatcggcg acctgtcccg ggagacgggg ctcactgccg gcagtcttta caaggccttt       120
     gccgacaaga acgcgatatt cgttgccgcg ttgaaccggt acatcgatcg gcgcgtaagc       180
     gagctcaacg tgatccttgc cgatgaaaaa agcggacgag acaaggtgcg agcgctcctg       240
     cgcttttacg cggacgtctc gcatggagac gagggtcgaa agggctgtct ggtcgtcgcc       300
     ggcgccattg ttctgagtac gctggatagc gagatcgccg gcatcgtcca caaatcgatg       360
     cagaggatcg agcgtctcct tcgcgatttg atcaagcaag ggcaggccga tggatccgtc       420
     gatgccgcgc tgaacgcgca agccgcgtcg agctgtctgt ttgccatggt gcaggggctt       480
     cgagtggtgg ggaagctcgg ccagagccgg agcgacatgt cgatgctggt cgacgaggca       540
     atgcggctgc tcgactaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page