(data stored in ACNUC1104 zone)

EMBL: CP000959.PE393

CP000959.PE393       Location/Qualifiers
FT   CDS_pept        467682..468407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3582"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bur:Bcep18194_B2137 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92734"
FT                   /db_xref="GOA:B1K380"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B1K380"
FT                   /protein_id="ACA92734.1"
FT                   /translation="MQYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAM
FT                   MRMMDSAKAECVPFAPPFLKAGDVVVGQTANILLFLGARLGLAPDDEAGRLWVHQIQLT
FT                   AADFVTEIHDTHHPIGSGLYYEEQQAEAAERAADFLENRLPKFLGYFDRLLEQNPHKSG
FT                   YIAGSALTYADLTMFQLIEGLRYAFPKAMKRAERKVAALVALHDRVAQHPPVARYLESE
FT                   RRIPFNDMGIFRHYPELDK"
     atgcaatacg aactctatta ctggcccgag atccagggcc gcggcgaata cgtgcggctc        60
     gcgctcgagg cggccgaggc cgattacgtc gacgtcgcgc gcgaatcggg gcgcggaatg       120
     ggcgtgtcgg ccatgatgcg catgatggac agcgcgaagg ccgaatgcgt gccgttcgcg       180
     ccgccgttcc tgaaggccgg cgacgtggtc gtcgggcaga ccgcgaacat cctgctgttt       240
     ctcggcgcgc ggctcgggct cgcgcctgac gacgaagccg gccggctgtg ggtgcaccag       300
     atccagctga ccgccgccga tttcgtcacc gagatccacg acacccacca tccgatcggc       360
     agcggcctct actacgagga gcagcaagcg gaagcagccg agcgcgccgc cgatttcctc       420
     gagaaccggc tgccgaaatt cctcggctac ttcgatcgcc tgctcgaaca gaatccccac       480
     aagagcggct atatcgccgg cagcgcgctc acctatgcgg acctgacgat gttccagttg       540
     atcgagggcc tgcgctacgc gttcccgaaa gcgatgaagc gcgcggagcg caaggtcgcg       600
     gcgctggtcg cgctgcacga tcgcgtcgcg cagcatccgc cggtcgcgcg ctacctcgag       660
     tcggaacgcc gcatcccgtt caacgacatg gggatcttcc ggcactatcc ggagctggac       720
     aagtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page