(data stored in ACNUC1104 zone)

EMBL: CP000959.PE394

CP000959.PE394       Location/Qualifiers
FT   CDS_pept        complement(468460..470022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3583"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B2141 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92735"
FT                   /db_xref="GOA:B1K381"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1K381"
FT                   /protein_id="ACA92735.1"
FT                   /translation="MDAMQAAAETAAPSGTTLKRRLQGRHIAMIAIGGSIGTGLFVASG
FT                   ASVAQAGPGGAIAAYLAIGIMVYFVVTGLGEMAALMPVSGSFAIYGEKYVDEGFGVALG
FT                   WTYWYSWAVTIAIELVAAQIVMRYWFPSVPGVSWGAGFLVLIFLLNTLSVRGFGESEYW
FT                   FSLIKVVTVIAFIAAGLLIAAGVLGDGHTGTGYAGTGHTVGWRNFTTGDAPFVGGVHAM
FT                   MSVALIAGFSFLGTELVGITAGESENPRKTIPRAVKQIFWRIMLFYVLAIFVIGLLVPY
FT                   TDPNLLKSDVTDVGVSPFTLVFSHAGFPLAAGAMNLVILTAVLSAGNSGTYAATRMLYN
FT                   LASEGRAPAMFATLSPGGVPRNALYATMAVGGLCFLTSLTNNQRIYLWLLNTVGITGFI
FT                   AWLGIAVCHYRFRKGFLKQGYRLDQLPYRAKWFPFGPLFAIAICIVISLGQDYQAFFAA
FT                   RIDWMEVLSIYVWIPLFVAIWWAYRRARKSRLVRYEEMDIGPWLTRSVGAVDAAAAQHG
FT                   QPH"
     atggatgcta tgcaagcggc agcggagacg gccgcgccgt ccgggacgac gctgaagcgc        60
     cgtctgcagg gccgccacat cgcgatgatc gcgatcggcg gttcgatcgg cacggggctg       120
     ttcgtcgcgt cgggcgcgtc ggtcgcgcag gcggggccgg gcggggcgat cgccgcgtat       180
     ctcgcgatcg ggatcatggt ctacttcgtc gtcacggggc tcggcgagat ggccgcgctg       240
     atgccggtat cgggctcgtt cgcgatctac ggcgagaagt atgtcgacga aggcttcggc       300
     gtcgcgctgg gctggaccta ctggtacagc tgggcggtga cgatcgcgat cgagctggtc       360
     gccgcgcaga tcgtgatgcg ctactggttt ccgtcggtgc cgggcgtgtc gtggggcgcg       420
     ggtttcctcg tgctgatttt cctgctcaat acgctgtcgg tgcgcggctt cggcgaatcg       480
     gaatactggt tctcgctgat caaggtcgtc accgtgatcg cgttcatcgc ggccgggctg       540
     ctgatcgcgg ccggcgtgct gggcgacggg cataccggca ccgggtatgc cggcaccggg       600
     cataccgtcg gctggcgcaa cttcacgacc ggcgacgcgc cgttcgtcgg cggcgtgcac       660
     gcgatgatga gcgtcgcgct gatcgcgggc ttctcgttcc tcggcaccga gctggtcggc       720
     atcacggccg gcgaatcgga aaacccgcgc aagacgattc cgcgcgcggt gaagcagatc       780
     ttctggcgga tcatgctgtt ctacgtgctc gcgatcttcg tgatcggcct gctcgtgccg       840
     tacaccgatc cgaacctgct gaagagcgac gtgaccgatg tcggcgtgag cccgtttacg       900
     ctggtgttca gccacgcggg gttcccgctc gccgccggcg cgatgaatct ggtgatcctg       960
     acggccgtgt tgtcggccgg caattccggc acctacgcgg cgacgcggat gctgtacaac      1020
     ctcgcgtcgg aagggcgcgc gccggcgatg ttcgcgacgc tgtcgccggg cggcgtgccg      1080
     cgcaacgcgc tgtacgcgac gatggccgtc ggcgggttgt gcttcctcac gtcgctgacc      1140
     aacaaccagc gcatctatct gtggctgctg aatacggtcg gcatcaccgg cttcatcgcg      1200
     tggctcggca ttgcggtctg ccattaccgg ttccgcaagg gattcctgaa gcagggctat      1260
     cgtctcgatc agctgccgta tcgcgcgaaa tggtttccgt tcgggccgtt gttcgcgatc      1320
     gcgatctgca tcgtcatttc gctcggccag gattaccagg cgtttttcgc ggcacgcatc      1380
     gactggatgg aagtgctgtc gatctatgtg tggattccgc tgttcgtcgc gatctggtgg      1440
     gcgtatcgcc gcgcgcgcaa gagccggctc gtgcgctacg aggagatgga catcgggccg      1500
     tggctcacgc gctcggtcgg ggccgtcgac gcggccgccg cgcagcacgg gcagccgcat      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page