(data stored in ACNUC1104 zone)

EMBL: CP000959.PE397

CP000959.PE397       Location/Qualifiers
FT   CDS_pept        complement(471654..472904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3586"
FT                   /product="protein of unknown function DUF1479"
FT                   /note="PFAM: protein of unknown function DUF1479; KEGG:
FT                   bur:Bcep18194_B2144 protein of unknown function DUF1479"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92738"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:B1K384"
FT                   /protein_id="ACA92738.1"
FT                   /translation="MQLTIDDLPAAIRAAKRALRADLPDYAATFREVEGDIARQVDAIR
FT                   RAHAHGQDVIPVVPFADIAGGRVDPHAMAAIRTHGAVVIRGVFDARQARDWNDEIGAYL
FT                   DANRFTERLHARAEDRYFGNLASGKPQIYGVYWSKPQVAARQSPALTQARVFLNRLWRH
FT                   ADGARTHFDPDQVPAYADRIRRRPPGSTSLGLSPHVDGGSVERWLGANFRQVYRHVLAG
FT                   RWRDYDPFDAAFRPDVEEIPSPAVCSMFRTFQGWTALTPQGPGDGTLQLIPVANAMAYV
FT                   VLRALQDDVADDDLCGARPGRALSIRPEWHALLLDALVPIPHMEPGDAVFWHGDVVHAV
FT                   EDAHRGSGDSNVMYIAAAPGCAKNDAYLQRQRVAFLRGDSPPDFPADHFEVDFDGRAQA
FT                   GELTALGRAQMGFAPDA"
     atgcaactga cgattgacga tctgcccgcc gcgattcgcg cggcgaaacg ggcgctgcgc        60
     gccgacctgc ccgattacgc ggccacgttc cgcgaagtgg agggcgacat cgcacggcag       120
     gtcgacgcga tccgccgcgc gcacgcgcac ggccaggacg tgattccggt cgtgccgttc       180
     gcggatatcg cgggtgggcg ggtcgatccg cacgcgatgg ccgcgatccg cacgcatggc       240
     gcggtggtga ttcgcggcgt gttcgatgcg cggcaggcgc gcgactggaa tgacgagatc       300
     ggcgcgtatc tggatgcgaa ccgtttcacc gagcggctgc atgcacgcgc ggaagaccgc       360
     tatttcggca atctcgcgtc gggcaagccg cagatttacg gggtttattg gtcgaagccg       420
     caggtggccg cgcgccagtc gccggcgctg acgcaggcgc gggtgttcct gaaccgtctg       480
     tggcggcatg cggacggtgc gcgcacccat ttcgatcccg atcaggtgcc tgcgtacgcg       540
     gaccggattc gccgccggcc gcccggttcg acgtcgctcg ggctgtcgcc gcatgtcgac       600
     ggcggctccg tcgagcgctg gctcggcgcg aattttcggc aggtctatcg tcacgtgctg       660
     gccgggcgct ggcgcgacta cgatccgttc gatgcggcgt tccgccccga cgtcgaggaa       720
     attccgtcgc cggccgtgtg ttcgatgttc cgcacgttcc agggctggac cgcgctgacg       780
     ccgcaagggc ccggcgacgg cacgctgcag ctgattccgg tcgcgaatgc gatggcctat       840
     gtcgtgctgc gcgcgctgca ggacgacgtc gccgacgacg acctgtgcgg cgcgcgtccc       900
     ggccgcgcgc tgtcgatccg cccggaatgg cacgcgctgc tgctcgacgc gctcgtgccg       960
     atcccgcaca tggagccggg cgacgcggtg ttctggcatg gcgacgtcgt gcatgcggtc      1020
     gaggatgcgc atcgcggcag cggcgacagc aacgtgatgt acatcgcggc cgcgcccggc      1080
     tgcgcgaaga acgatgcgta cctgcaacgc cagcgtgtgg cgttcctgcg cggcgacagc      1140
     ccgcccgatt tcccggccga tcatttcgag gtcgatttcg acgggcgcgc gcaggcgggc      1200
     gaactcacgg cgctcggccg tgcgcagatg gggttcgcgc ccgacgcgta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page