(data stored in ACNUC1104 zone)

EMBL: CP000959.PE399

CP000959.PE399       Location/Qualifiers
FT   CDS_pept        473475..474452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3588"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B2146 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92740"
FT                   /db_xref="GOA:B1K386"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B1K386"
FT                   /protein_id="ACA92740.1"
FT                   /translation="MKPQYEHVTFASGCSIRVYHRQLARIPFEWHRHPEYELTLTLNSR
FT                   GQRFIGDHVARYADDDLVLVPPNLPHTWSSNARIDRDAPEVALVVWFDGDWMRRLADCC
FT                   PEYAPLRSLLRRAAPGLHFDVETARAMRARLPRLLDPSPRVRLAATLDTLADLAETGGE
FT                   PLATAQAYDLADGAPSPADPAAPEAERLDRVLDAIDRHFHEPLRIDALAAVAHLSERTL
FT                   QRLFVRHLGESVGRYVQRLRLAHACRHLVGTDWPIATVAARCGIPNTANFNRQFLAARG
FT                   TTPGAYRQFFKQHGHAPDGDAPALDTRPPSLEHRGGSGQRRPHK"
     atgaaaccgc aatacgagca cgtgacgttt gcgtccggct gctccatccg cgtctatcac        60
     cgccagctcg cgcgcattcc gttcgaatgg catcgccacc ccgagtacga gctgacgctg       120
     acgctcaaca gccgcggcca gcgcttcatc ggcgaccacg tcgcgcgtta cgcggacgac       180
     gatctcgtgc tcgtgccgcc gaacctgccg catacgtggt cgtcgaacgc gcgcatcgat       240
     cgcgacgcgc ccgaggtcgc gctcgtcgtc tggttcgacg gagactggat gcggcggctg       300
     gccgactgct gccccgaata cgcgccgctg cgctcgctgt tgcgacgtgc ggcgccgggc       360
     ctgcacttcg acgtggagac ggcccgcgcg atgcgcgcgc ggctgccgcg gttgctcgat       420
     ccgtcgccgc gcgtgcggct cgcggccacg ctcgacacgc ttgccgatct cgcggaaaca       480
     ggcggcgaac cgctcgccac cgcgcaggcg tacgacctgg ccgatggcgc gccgtcgccc       540
     gccgacccgg ccgcccccga agccgaacgc ctcgaccgcg tgctcgacgc gatcgaccgg       600
     catttccacg aaccgctgcg catcgacgcc ctcgccgccg tcgcgcacct gtccgaacgc       660
     acactgcaac ggctgttcgt ccggcatctc ggcgaaagcg tcggccgcta cgtgcagcgg       720
     ctgcggctcg cgcacgcgtg ccgccatctc gtcggcaccg actggccgat cgcgacggtg       780
     gccgcgcgct gcggcattcc gaataccgcg aacttcaatc gccagttcct cgccgcgcgc       840
     ggcacgacgc ccggcgcata ccggcagttc ttcaagcagc atggccatgc acccgacggc       900
     gatgcgcccg cgctcgacac acggccaccg tcgctggagc accgcggcgg atcgggccaa       960
     cgtcggccgc acaaatga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page