(data stored in ACNUC1104 zone)

EMBL: CP000959.PE402

CP000959.PE402       Location/Qualifiers
FT   CDS_pept        complement(476190..476891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3591"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: bam:Bamb_3314
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92743"
FT                   /db_xref="GOA:B1K389"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B1K389"
FT                   /protein_id="ACA92743.1"
FT                   /translation="MAKRIFEVYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKALD
FT                   ETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMT
FT                   HFFNQYHSIKPYLINDAPPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
     atggcaaaac gcatttttga agtctaccgc tacgatccgg acaaggacgc agcgccgcgc        60
     atgcagacgt acgagctcga gatccagcat gaacgcatgc tgctcgacgc gctggtcaag       120
     ctgaaggcac tggacgagac gctgtcgttc cgccgctcgt gccgtgaagg cgtgtgcggt       180
     tcggacgcga tgaacatcaa cggcaagaac ggtctcgcgt gcctgacgaa cctgaacgac       240
     ctgccgcaga agatcgtgct gcgtccgctg ccgggcctgc cggtcgtgcg cgacctgatc       300
     gtcgacatga cgcacttctt caaccagtac cactcgatca agccgtacct gatcaacgac       360
     gcgccgccgc cggagaagga acgcctccag tcgccggaag agcgcgacga gctcgacggc       420
     gtgtacgagt gcattctgtg cgcgagctgc tcgacgtcgt gcccgagctt ctggtggaac       480
     cccgacaagt tcgtcggccc ggccggcctg ctgcaggctt accgcttcat cgcggacagc       540
     cgcgacaccg ccaccggcga gcgtctcgac aacctggaag acccgtaccg tctgttccgt       600
     tgccacacga tcatgaactg cgtcgacgtt tgcccgaagg gcctgaaccc gacgaaggcg       660
     atcggcaaga tcaaggaact gatggttcgt cgcgcggtat aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page