(data stored in ACNUC1104 zone)

EMBL: CP000959.PE403

CP000959.PE403       Location/Qualifiers
FT   CDS_pept        complement(476914..478689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3592"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: bam:Bamb_3313 succinate dehydrogenase,
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92744"
FT                   /db_xref="GOA:B1K390"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B1K390"
FT                   /protein_id="ACA92744.1"
FT                   /translation="MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKT
FT                   QFFVEWMALDLIRDADGDVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARSGIALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDAIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSRDHKEPVNGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVEHVKNQKEHKPLPADAGEFSLARLAKLEKSSSGEY
FT                   TQDVANDIRATMQKHAGVFRTSALLKEGVAQMADLKARVENIHLKDKSKVFNTARVEAL
FT                   ELENLIEVARATMVSAEARKESRGAHAHSDYEHRDDDNWLRHTLWYSEGDRLDYKPVQM
FT                   KPLTVESVPPKPRTF"
     atggctgcaa tcaaaacttc cctcccgcgc cgcaagttcg acgtcgtgat cgtcggcgca        60
     ggcggctccg gcttgcgcgc agcgctgcaa ctgtcgcgcg cgggcctgtc ggtcggcgtg       120
     ctgtcgaagg tgttcccgac gcgttcgcac acggtggccg cgcagggcgg tatcggcgcg       180
     tcgctcggca acatgagcga agacaactgg cactaccact tctacgacac gatcaagggc       240
     tccgactggc tcggcgacca ggatgcgatc gagttcatgt gccgtgaagc gccgaacgtc       300
     gtgtacgaac tcgagcactt cggcatgccg ttcgaccgca acgcggacgg cacgatctac       360
     cagcgcccgt tcggcggcca taccgcgaac tacggcgaga agccggtcca gcgcgcttgc       420
     gcggccgccg accgtaccgg tcacgcgctg ctgcacacgc tgtaccagca gaacgtcgaa       480
     gcgaagacgc agttcttcgt cgaatggatg gcgctcgacc tgatccgcga cgcggacggc       540
     gacgtactcg gcgtgacggc cctcgagatg gagacgggcg acgtctacat catggaaggc       600
     aagaccacgc tgttcgcgac gggcggcgca ggccggatct tcgcggcatc gacgaacgcg       660
     ttcatcaaca ccggcgacgg cctcggcatg gcggcgcgct cgggcatcgc gttgcaggac       720
     atggagttct ggcagttcca cccgaccggc gtggccggcg cgggcgtgct gatcaccgaa       780
     ggcgtgcgcg gcgaaggcgg tatcctgcgc aacgcgaacg gcgagcgctt catggagcgc       840
     tacgcgccga cgctgaagga tctggcgccg cgtgacttcg tgtcgcgttc gatggaccag       900
     gaaatcaagg aaggtcgcgg cgtcggtccg aacaaggatc acgtgctgct cgacctgtcg       960
     cacatcggcg ccgagacgat catgaagcgt ctgccgtcga tccgcgaaat cgcgctgaag      1020
     ttcgcgaacg tcgacgcgat caaggaaccg atcccggtcg tcccgacgat ccactaccag      1080
     atgggcggca tcccgaccaa catccacggt caggtcgtcg gcacgtcgcg cgatcacaag      1140
     gaaccggtca acggcttcta cgcagtgggc gaatgctcgt gcgtgtcggt gcacggcgcg      1200
     aatcgtctgg gcacgaactc gctgctggac ctcgtggtgt tcggccgtgc ggccggcaac      1260
     cacatcgtcg agcacgtgaa gaaccagaag gaacacaagc cgctgccggc tgacgcaggc      1320
     gaattctcgc tggcgcgcct ggcgaagctc gagaagtcga gctcgggcga gtacacgcag      1380
     gacgtcgcga acgacatccg cgcgacgatg cagaagcatg caggcgtgtt ccgcacgtcg      1440
     gcgctgctga aggaaggcgt cgctcagatg gccgacctga aggcgcgcgt ggaaaacatc      1500
     cacctgaagg acaagtcgaa ggtgttcaac accgcgcgcg tcgaagcgct cgagctggag      1560
     aacctgatcg aagtggctcg cgccacgatg gtgtcggccg aagcgcgcaa ggaaagccgc      1620
     ggtgcacacg cacacagcga ctacgaacac cgcgacgacg acaactggct gcgccacacg      1680
     ctgtggtaca gcgaaggcga tcgcctcgac tacaagccgg ttcaaatgaa gccgctgacg      1740
     gtcgaatccg tgccgccgaa gccgcgcacg ttctaa                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page