(data stored in ACNUC1104 zone)

EMBL: CP000959.PE406

CP000959.PE406       Location/Qualifiers
FT   CDS_pept        complement(479651..480475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3595"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bur:Bcep18194_B2153 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92747"
FT                   /db_xref="GOA:B1K393"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K393"
FT                   /protein_id="ACA92747.1"
FT                   /translation="MRAMTSNQANTANQTGAGGPGQPGAGDPAASPAASASPTFSPLYQ
FT                   QIKSLITQSLESGEWKPGEIIPSEVELAARYKVSQGTVRKAIDELAAENLVVRRQGKGT
FT                   FVATHNEDRAQFRFLRLLADDGAEHPHVSRLLECRRLRAPAEIARQLDLKPADPVVQVR
FT                   RLLEFDSEVTVLDEIWLPGAMFRGLTFERLSEYKGPLYAMFETEFGTRMIRATEKIRAV
FT                   AADPAVADLLHVPAGFPLLSVERVSYTYGDRPVEVRRGWYVTTGYYYQNDLS"
     atgcgcgcca tgacatcgaa ccaggcgaac accgcgaatc agaccggcgc aggcggccca        60
     gggcagccgg gcgcgggcga tcccgcagcc tcgcccgcgg cctccgcgtc gccgacgttc       120
     agcccgttat accagcagat caagtcattg atcacgcaaa gtctcgaatc cggcgaatgg       180
     aagccgggcg agatcatccc cagcgaagtg gagctcgcgg cccgttacaa ggtcagccag       240
     ggcaccgtgc gcaaggcgat cgacgaactg gccgccgaaa acctcgtcgt ccggcggcag       300
     ggcaagggca cttttgttgc aacgcacaat gaggatcgcg cgcagttccg tttcctgcgt       360
     ctcctggccg atgacggtgc cgagcacccg cacgtgagcc gcctgctcga atgccggcgc       420
     ctgcgtgcgc cggcggagat cgcgcggcag ctcgacctga agcccgccga tcccgtcgtg       480
     caggtgcgcc gcctgctgga attcgacagc gaagtgacgg tgctcgacga gatctggctg       540
     ccgggcgcga tgttccgcgg gctcacgttc gagcggctga gcgagtacaa ggggccgctc       600
     tacgcgatgt tcgagacgga gttcggtacg cggatgatcc gcgcgacgga gaagatccgc       660
     gcggtggcgg cggacccggc ggtggccgac ctgctgcacg tgccggcggg gttcccgttg       720
     ctgtcggtcg agcgcgtgtc ctatacgtac ggggaccggc cggtggaagt gcgtcgcggc       780
     tggtatgtca caaccgggta ctactatcag aatgacttga gctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page