(data stored in ACNUC1104 zone)

EMBL: CP000959.PE408

CP000959.PE408       Location/Qualifiers
FT   CDS_pept        481936..482943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3597"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bur:Bcep18194_B2155
FT                   citrate lyase beta subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92749"
FT                   /db_xref="GOA:B1K395"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1K395"
FT                   /protein_id="ACA92749.1"
FT                   /translation="MAALTPAQVLYDGASPPAILPCCDHYAGSEKLMRKSLALQAELGP
FT                   VFDLTLDCEDGATVGQEAAHAALVADLLGSAENRFGRVGVRIHDFSHPHWRDDVRIVLR
FT                   ASRAPAYITLPKIANAADAAEMTAFIEGTRRELGIAQPIPVDVLIETHGALAQAAALAA
FT                   LPTVGTLSFGLMDFVSAHHGAIPDSAMRSPGQFDHPLVRRAKLEIAAACHAHGKTPSHN
FT                   VTTEVRDMGVVAGDARRARDEFAFTRMWSIHPAQIRPIVDAFAPRTDEVTLAAEILLAA
FT                   QAADWGPTRHGDTLHDRASYRYYWSVLRRARATGQPVPDEAAPLFGPAAAGAAP"
     atggccgcgc tcactcctgc acaagtgctg tacgacgggg cgtccccgcc cgcgatcctg        60
     ccctgctgcg atcactacgc gggcagcgag aagctgatgc gcaagtcgct cgcgctgcag       120
     gccgagctgg gcccggtgtt cgacctcacg ctcgactgcg aggacggtgc gaccgtcggc       180
     caggaagccg cccacgcggc gctcgtcgcc gacctgctcg gcagcgccga gaaccgcttc       240
     ggccgcgtcg gcgtccgtat ccacgacttt tcccacccgc actggcgcga cgacgtgcgc       300
     atcgtgctgc gtgcgtcgcg cgcacccgcc tacatcacgc tgccgaagat cgcgaacgcc       360
     gccgacgcgg ccgaaatgac cgcgttcatc gaaggcacgc gccgcgaact gggcatcgcg       420
     cagccgatcc cggtcgacgt gctgatcgag acgcacggcg cgctcgcgca ggcggccgct       480
     ctcgccgcac tgccaacggt cggcacgctg agcttcgggc tgatggattt cgtctccgcg       540
     caccacggcg cgatccccga ttccgcgatg cgctcgcccg gccagttcga ccacccgctc       600
     gtgcgccgcg cgaagctgga aatcgccgcg gcctgtcatg cgcacggcaa gacgccgtcg       660
     cacaacgtga cgaccgaggt gcgcgacatg ggcgtcgtcg ccggcgatgc acgccgcgcg       720
     cgcgacgaat tcgctttcac gcggatgtgg agcatccatc ccgcgcagat ccgcccgatc       780
     gtcgacgcct tcgcgccgcg caccgacgaa gtcacgctgg ccgccgagat cctgctcgcc       840
     gcgcaggccg ccgactgggg cccgacgcgc cacggtgata cgctgcacga tcgcgcgagt       900
     taccgttatt actggtcggt gctgcgccgt gcgcgggcca ccggccagcc cgtaccggac       960
     gaggccgcgc cgctgttcgg cccggccgcc gcgggcgccg cgccttga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page