(data stored in ACNUC1104 zone)

EMBL: CP000959.PE409

CP000959.PE409       Location/Qualifiers
FT   CDS_pept        483174..483689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92750"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3M9"
FT                   /protein_id="ACA92750.1"
FT                   /translation="MKKLLIATAIGALSATMLVSAPSAFAQGTATTTAKKATAKRPAPA
FT                   KRIIPRSKKAQARAAAKVDPVPDGAVKWACKEGLSFDLAGDMKRDQVVTVHWAKKNYKL
FT                   PRQATTTGADTFYDPAAGFKLVVIPTKAMLFSDANGGERLADECVTPEMAQGNAAPTQS
FT                   NELKPAAN"
     atgaagaaac tcctgatcgc taccgccatc ggcgccttgt ccgccacgat gctggtgtcg        60
     gctccgagcg cgtttgccca gggtacggcc accacgaccg cgaagaaggc cacggccaag       120
     cgcccggcgc cggccaagcg catcatcccg cgcagcaaga aggcgcaggc gcgcgcagcc       180
     gccaaggtcg atccggtacc ggacggcgcg gtcaagtggg cctgtaagga aggcctgtcg       240
     ttcgacctcg ccggcgacat gaagcgcgac caggtcgtca cggttcattg ggcgaagaag       300
     aactacaagc tgccgcgtca ggccacgacg acgggcgccg acacgttcta cgatccggca       360
     gccggcttca agctggtcgt gatcccgacc aaggcgatgc tgttctccga cgcgaacggc       420
     ggcgagcgtc tcgcggacga atgcgtgacg ccggaaatgg cacagggcaa cgcagcgccg       480
     acgcagtcga acgagctgaa gccggccgcg aactaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page