(data stored in ACNUC1104 zone)

EMBL: CP000959.PE414

CP000959.PE414       Location/Qualifiers
FT   CDS_pept        complement(488978..489301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3603"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   bur:Bcep18194_B2161 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92755"
FT                   /db_xref="GOA:B1K3N4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3N4"
FT                   /protein_id="ACA92755.1"
FT                   /translation="MQTAHDTLFRTLADPTRRALFERLCAEGELTVAALTAHAGVSQPA
FT                   VSKHLGVLKQAGLVNDRHEGRQTHYSAQPQALAPLIDWTSQMAGFWQSRFDALEDLLKR
FT                   MDQ"
     atgcagaccg ctcacgacac gctgttccgc acactcgccg atcccacgcg ccgcgcgctt        60
     ttcgagcggc tctgcgcgga gggcgagctg acggttgccg cgctgaccgc ccacgcgggc       120
     gtgtcgcagc cggccgtgtc gaagcacctt ggcgtactga agcaggccgg gctcgtgaac       180
     gaccgtcacg aaggccggca gacgcactac agcgcgcagc cgcaggcgct ggccccgttg       240
     atcgactgga cgagccagat ggcgggcttc tggcagagcc ggttcgatgc cctcgaagat       300
     ctgctcaaaa ggatggatca gtaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page