(data stored in ACNUC1104 zone)

EMBL: CP000959.PE419

CP000959.PE419       Location/Qualifiers
FT   CDS_pept        complement(495769..496815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3608"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bur:Bcep18194_B2169 ABC spermidine/putrescine
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92760"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3N9"
FT                   /protein_id="ACA92760.1"
FT                   /translation="MKRASFTARRTALALALVAFGASATAAELTVVNFGGANGDAQKVA
FT                   FNQPFEKATGNKVTAVEYNGEQAKVKAMVEAKHVNWDVVEVESGDLNRGCDEGLYEKLD
FT                   WSKIAKKSDLIPESPQVCGVGFFVWSTALSYNADKLKSAPTGWADFWNVKKFPGKRGMR
FT                   KGARYNLEFALMADGVATKDVYKVLGTKAGQDRAFKKLDELKPYIQWWEAGAQPPQFLV
FT                   AGDVVMSTAYNGRIDAAQKEGKNLKVVWNGSIYDLDYWAIPKGSPNKALAEQYIAYSLT
FT                   PKPQQAYAQHIAYGPANIAAIKALDAKTLANLPNSPANGKNAVLEDIGFWTDHSDELEQ
FT                   RFAAWATK"
     atgaaacgag caagctttac cgcgcgccgc acggcgctcg cgctggccct ggtcgcattc        60
     ggcgcatcgg ccaccgctgc cgagctcacg gtcgtcaact tcggcggcgc gaacggcgac       120
     gcacagaagg tcgcgttcaa ccagccgttc gagaaggcga ccggcaacaa ggtcacggcc       180
     gtcgaataca acggcgagca ggcgaaggtg aaggcgatgg tcgaggcgaa gcacgtcaac       240
     tgggacgtgg tggaagtcga atcgggcgac ctgaaccgcg gctgcgacga agggctgtac       300
     gagaagctcg actggtcgaa gatcgcgaag aaatccgacc tgattccgga atcgccgcag       360
     gtgtgcggcg tcggcttctt cgtgtggtcg acggcgctgt cgtacaacgc ggacaagctg       420
     aagtcggcgc ccaccggctg ggccgatttc tggaacgtga agaaattccc cggcaagcgc       480
     gggatgcgca agggcgcgcg ctacaacctc gaattcgcgc tgatggccga cggcgtcgcg       540
     acgaaggacg tctacaaggt gctcggcacg aaggccggcc aggatcgcgc gttcaagaag       600
     ctcgacgagc tgaagccgta catccagtgg tgggaagcag gcgcgcagcc gccgcagttc       660
     ctcgtcgccg gcgacgtcgt gatgtcgacc gcgtacaacg gccgcatcga cgccgcgcag       720
     aaggaaggca agaacctgaa ggtcgtgtgg aacggcagca tctacgacct cgactactgg       780
     gcgattccga agggttcgcc gaacaaggcg ctggccgagc agtacatcgc gtactcgctg       840
     acgccgaagc cgcagcaggc gtatgcgcag cacatcgcgt acggtccggc gaacatcgcg       900
     gcgatcaagg cgctcgacgc gaagacgctc gcgaacctgc cgaactcgcc ggccaacggc       960
     aagaacgcgg tgctggagga catcggcttc tggaccgacc acagcgacga gctcgaacag      1020
     cgcttcgccg catgggcaac gaagtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page