(data stored in ACNUC1104 zone)

EMBL: CP000959.PE42

CP000959.PE42        Location/Qualifiers
FT   CDS_pept        50588..51283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3227"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: bur:Bcep18194_B1729 two component
FT                   heavy metal response transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92383"
FT                   /db_xref="GOA:B1K8N6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8N6"
FT                   /protein_id="ACA92383.1"
FT                   /translation="MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDY
FT                   DVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTARDRVDDRVRGLRGGADDYLTKPFSF
FT                   LELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGARLDLTAQEFQLLGVLARR
FT                   SGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFAEKLLHTIRGMGYVLEAR
FT                   EDGDTERRA"
     atgaaagtac tgatcgtcga ggacgaaccg aaagtcgtcg aatacctgaa gagcggcctg        60
     accgaggaag gctgggtcgt cgacaccgcg ctcgacggcg aggacggcgc gtggaaagcc       120
     gtcgaattcg actacgacgt ggtcgtgctc gacgtgatgc tgccgaagct cgacggcttc       180
     ggcgtgctgc gtgcattgcg cgcgcagaag cagacgcccg tcatcatgct gaccgcgcgc       240
     gatcgcgtcg acgaccgcgt gcggggcttg cgtggcggcg ccgacgacta cctgaccaag       300
     ccgttctcgt tcctcgaact gatcgaacgg ctgcgtgcgc tgacgcgccg cgcccgcgtg       360
     caggaatcga cgctgatctc gatcggcgac ctgcgcgtcg acctgatcgg ccgccgcgcg       420
     acccgcgacg gcgcgcggct cgacctgacc gcgcaggaat tccagctgct cggcgtgctc       480
     gcccggcgca gcggcgaggt gctgtcgaag acgaccatcg ccgagcttgt gtgggacgtg       540
     aacttcgaca gcaatgcgaa cgtcgtcgag acggcgatca agcgcctgcg cgcgaaactc       600
     gatggcccgt tcgcggagaa gctgctgcac acgatccgcg ggatgggcta cgtgctcgag       660
     gcgcgcgagg acggcgacac ggagcggcgc gcatga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page