(data stored in ACNUC1104 zone)

EMBL: CP000959.PE421

CP000959.PE421       Location/Qualifiers
FT   CDS_pept        498113..499636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3610"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B2171 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92762"
FT                   /db_xref="GOA:B1K3P1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3P1"
FT                   /protein_id="ACA92762.1"
FT                   /translation="MDTVIVADWLSARLDRSSSEPMYRQLLQLMQQAILTGELGPGTKL
FT                   PSSRTLAGDLSIARNTVLHVYDQLTAEGYVLTTTGSGTYVADTRPDAAAIRVPGAPPPP
FT                   AAADEPPLPDAQGSLSMRGRQLVEHAGVSRRQWGAFMPGVPDVSEFPSRTWSRLQARLW
FT                   KEANPELLTYAPGGGYRPLRRALADYLRVARSVKCSPDQVIITTGIHQSIDLAVRLLSD
FT                   IGDRAWVEEPCYWGVRSVLQAAGLTLAPVPVDQEGLDPRASDMQHPPRLVLVTPSHQYP
FT                   LGMVMSLARRRMLLEYARQHRCWIIEDDYDSEFRYGSRPLASLQGLDDGGRVIYVGSLG
FT                   KMLFPGLRMGYMVVPEHLVDTFRTGLSELYREGQLMQQAVLAEFIMDGHLTSHVRRMRT
FT                   LYGERRQLMIDAIRARFGDALPVMGDEAGLHLVLGLPDACDDRAVTQSAFDAGVIVRPL
FT                   TSYYSNLDTARQGLLLGYACVAHEGIRPAFDTLANTIEQHLPRNITRAA"
     ttggataccg tgatcgtcgc cgactggctg tccgcccgtc tggaccgcag ctcgtccgag        60
     ccgatgtacc ggcaactgct gcagctgatg cagcaggcga ttctgacggg ggaattgggg       120
     ccaggaacaa agctcccgag ttcgcgcacg ctcgcgggcg acctgtcgat cgcgcgcaat       180
     accgtgctgc acgtgtacga ccagctgacc gccgaaggct acgtgctgac gaccactggc       240
     agcggcacct acgtggccga cacgcgaccg gacgccgccg cgatccgcgt accgggcgcc       300
     ccgccgccgc cggcggcggc cgacgaaccg ccgctgcccg acgcgcaggg cagcctgtcg       360
     atgcgcggcc ggcaactggt cgagcatgcg ggcgtctcgc ggcgccagtg gggggcgttc       420
     atgccaggcg tgccggacgt gtcggaattc ccgagccgca cgtggagccg cctgcaggca       480
     cggctgtgga aggaggccaa tccggagctg ctgacctatg cgccgggcgg cggctaccgg       540
     ccgctgcggc gcgcactcgc cgattacctg cgcgtcgcgc gctcggtcaa atgctcgcct       600
     gaccaggtga tcatcacgac cggtatccat cagtcgatcg atctcgcggt gcggctgctg       660
     tccgacatcg gcgatcgcgc gtgggtcgag gagccgtgct actggggcgt gcgcagcgtg       720
     ctgcaggcag ccggcctcac gctggcgccg gtgccggtcg accaggaagg gctcgatccg       780
     cgcgcgagcg acatgcagca tccgccgcgg ctcgtgctcg tcacgccgtc gcaccagtac       840
     ccgctcggga tggtgatgag cctcgcgcgg cgccgcatgc tgctcgaata tgcgcgccag       900
     caccgctgct ggatcatcga ggacgactac gacagcgaat tccgctacgg cagccgcccg       960
     ctcgcgtcgc tgcaggggct cgacgacggc ggccgcgtga tctacgtcgg cagtctcggc      1020
     aagatgctgt tccccgggtt gcggatgggc tacatggtcg tgcccgagca tctggtcgac      1080
     acgttccgca ccgggctgtc ggagctgtat cgggaaggcc agctgatgca gcaggccgtg      1140
     ctcgccgaat tcatcatgga cggccacctc acttcgcacg tcagacgaat gcgcacgctg      1200
     tacggcgagc gccggcaact gatgatcgac gcgatccgcg cgcgcttcgg cgacgcgctg      1260
     ccggtgatgg gcgacgaggc cggcctgcat ctggtgctcg gcctgcctga cgcgtgcgac      1320
     gatcgcgcag tcacacagag cgcattcgac gcgggcgtga tcgtgcgccc gctcaccagc      1380
     tactacagca acctcgacac cgcgcggcag ggcctgctgc tcggctatgc ctgcgtcgcg      1440
     cacgaaggca tccggcccgc gttcgacacg ctcgccaaca ccatcgagca acatctgccg      1500
     cgaaacatca cgcgcgcggc gtga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page