(data stored in ACNUC1104 zone)

EMBL: CP000959.PE427

CP000959.PE427       Location/Qualifiers
FT   CDS_pept        505451..506161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3616"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92768"
FT                   /db_xref="GOA:B1K3P7"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3P7"
FT                   /protein_id="ACA92768.1"
FT                   /translation="MENPHRAPERLWHDEALVRRRAGIMSKAFFVAAYRLIAALLAVST
FT                   TLHSVADYWRLPTFHLGNYLSYFTQLSSLYAAAMLAAGLWRIARPGSARYESMRGAAVL
FT                   YVLITAIVYELLLARLDALRHVTPAFNNWVLHRIVPLVMLCDWLYVEPRSPIPRRSAFA
FT                   WLGFPVVYLGYTLVRGAVEDWYPYPFVDPRPHGYLPVAIQCSLIALGAAALALGIRWLG
FT                   NHARQSGSATLKEG"
     atggaaaatc cgcatcgcgc gcccgagcgg ctgtggcacg atgaagcttt ggtgcgacgg        60
     cgcgcgggca tcatgagcaa agcgttcttc gttgcagcct accggctgat cgccgcattg       120
     ctcgcggtgt ccaccacgct gcacagcgtc gccgactact ggcgcctgcc gaccttccat       180
     ctcggcaact acctcagcta cttcacgcaa ctgagcagcc tctacgcggc cgcgatgctg       240
     gccgctgggc tgtggcgcat cgcgcgcccc ggctcggccc gctacgaatc gatgcgcggc       300
     gcggcggtgc tgtacgtgct gatcaccgcg atcgtctacg aactcctgct cgcgcggctc       360
     gatgcgctgc gccacgtcac gccggcgttc aacaactggg tactgcaccg gatcgtgccg       420
     ctcgtgatgc tgtgcgactg gctgtacgtc gaaccgcgct cgccgattcc gcgccgcagt       480
     gcgttcgcgt ggctcggctt tccggtcgtc tatctcggct atacgctggt gcgcggcgcg       540
     gtggaggact ggtatcccta cccgttcgtc gatccgcgtc cgcacggcta cctgcccgtc       600
     gcgatccagt gttcgctgat cgcgctcggc gcggcggcgc tcgcactggg cattcgctgg       660
     ctcggcaatc atgcgagaca gtctggcagc gcgacgctta aggaaggatg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page