(data stored in ACNUC1104 zone)

EMBL: CP000959.PE430

CP000959.PE430       Location/Qualifiers
FT   CDS_pept        complement(507802..508146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_4675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92771"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q0"
FT                   /protein_id="ACA92771.1"
FT                   /translation="MKSLIATFAAAAVLAVPAVSFAQQNAPVTRAQVKAELVQLQQAGY
FT                   KLGSDRTNYPEGIQAAEARVNPQQNVAAADTTGYGAQPAAGQESGAPAAAKTGWQVKRV
FT                   SDGAPVYKGR"
     atgaaatcgc tgatcgcaac gttcgctgct gctgctgtcc tcgctgtccc cgccgtctcg        60
     ttcgcccaac agaacgcgcc cgtcacccgt gcccaggtga aggccgaact ggtccagctg       120
     caacaggctg gctacaagct gggcagcgac cggaccaact acccggaagg catccaggct       180
     gctgaagctc gcgtgaaccc gcaacagaac gtcgccgctg ccgatacgac cggctacggt       240
     gcgcaaccgg ccgccggcca ggaatcgggc gccccggctg cggccaagac cggctggcaa       300
     gtcaagcgcg tctcggacgg cgcaccggtc tacaagggtc gttaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page