(data stored in ACNUC1104 zone)

EMBL: CP000959.PE431

CP000959.PE431       Location/Qualifiers
FT   CDS_pept        complement(508347..509759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3620"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="KEGG: bur:Bcep18194_B2181 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92772"
FT                   /db_xref="GOA:B1K3Q1"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q1"
FT                   /protein_id="ACA92772.1"
FT                   /translation="MGKQAIGVIGLAVMGRNLALNIESRGYAVSVFNRSREKTDELIAE
FT                   FPGRNLVPTYTLEEFVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTH
FT                   FTDTIRRNQELAQSGLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKA
FT                   PSDGEPCVAYMGPDGAGHYVKMVHNGIEYGDMQLIAESYSVLKDVAGLTNDELGAVYTE
FT                   WNQGELDSYLIEITSKIFGKKDEETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPL
FT                   ITESVFARVLSSLKTERVAASKILSGPAAAPFDGDRAAFVEAVRRALYLSKVISYAQGF
FT                   AQLRTASEEYGWNLDLGTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFKDI
FT                   AANYQTALRDVVVAAVKAGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFER
FT                   TDKPGSFHANWS"
     atgggcaaac aagcaatcgg tgtgatcggg ctcgcggtga tgggccgcaa tctcgcactc        60
     aatatcgaga gccgcggtta cgcggtgtcg gtgttcaacc gcagtcgcga gaaaaccgac       120
     gaactgatcg ccgaattccc cggccgcaat ctcgtgccga cctatacgct cgaggaattc       180
     gtcgcgtcgc tcgaaacgcc gcgccggatc ctgatgatgg tgaaggccgg ggaagcgacc       240
     gatgcgacga tcgcctcgct caagccgctg ctcgagaagg gcgacgtgct gatcgacggc       300
     ggcaacacgc atttcaccga cacgatccgc cgcaaccagg aactcgcgca gtcgggcctg       360
     catttcatcg gcaccggcgt gtcgggcggc gaagagggcg cactgcgtgg cccgtcgatc       420
     atgcctggcg gccagcgcga cgcgtacgat ctcgtcgagc cgatcctcaa gcagatcgcc       480
     gcgaaggcgc cgtcggacgg cgagccgtgc gtcgcgtaca tgggtccgga cggtgcgggc       540
     cactacgtga agatggtcca caacggcatc gaatacggcg acatgcagct gatcgccgag       600
     agctattcgg tgctgaagga cgtcgcgggc ctgaccaacg acgaactcgg cgcggtgtac       660
     accgaatgga accagggcga gctcgacagc tacctgatcg agatcacgtc gaagatcttc       720
     ggcaagaagg acgaagaaac cggcaagcac ctcgtcgacg tgatcctcga tcgcgccgcg       780
     cagaagggca ccggcaagtg gacgagccag aacgcgctgg atctcggcgt gccgctgccg       840
     ctgatcacgg agtcggtgtt cgcccgcgtg ctgtcgtcgc tgaagacgga gcgcgtcgcg       900
     gccagcaaga tcctgtcggg cccggccgcc gcgccgttcg acggcgatcg cgccgcgttc       960
     gtcgaagcgg tgcgccgcgc gctgtacctg agcaaggtga tctcgtacgc gcagggcttc      1020
     gcgcaactgc gcacggcgtc ggaagaatac ggctggaacc tcgatctcgg gacgatcgcg      1080
     aagatcttcc gcgcgggctg catcatccgc gcgcgcttcc tgcagaagat caccgacgcg      1140
     tatgcgaagg atccggcgct cgcgaacctg ctgctcgacc cgtacttcaa ggacatcgcc      1200
     gcgaactacc agacggcgct gcgcgatgtg gtggtggccg cggtgaaggc cggcgtgccg      1260
     gtcccggcgt tcgcatcggc ggtcgcgtac ttcgacagct accgttccga gcggctgccg      1320
     gcgaacctcg tgcaggcgca gcgcgacttc ttcggcgcgc acacgttcga gcgcaccgac      1380
     aagccgggca gcttccacgc gaactggtcg taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page