(data stored in ACNUC1104 zone)

EMBL: CP000959.PE432

CP000959.PE432       Location/Qualifiers
FT   CDS_pept        complement(509857..510498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3621"
FT                   /product="protein of unknown function DUF938"
FT                   /note="PFAM: protein of unknown function DUF938;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bur:Bcep18194_B2182 protein of unknown function DUF938"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92773"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q2"
FT                   /protein_id="ACA92773.1"
FT                   /translation="MTGAAASPDPSERLSAPAAERNRGPILDVLRRVLPASGSVLEIAS
FT                   GTGQHVVHFAQALPGLHWQPSDPDAQARRSIAAWVAHAGLANVAGPLAFDVRDAPWPVA
FT                   ALDAIVCINMIHISPWACTDALFAGASRVLRPGGVLFLYGPYRREGRHTAPSNEAFDRQ
FT                   LRSRDPSWGVRDLETVVALGLDLGLDCSEVVEMPANNLSVVFRRLPHAEQ"
     gtgaccggcg ccgctgcttc gcccgatccg tccgagcggc tgtccgcgcc ggcggccgaa        60
     cgcaatcgcg ggccgatcct cgacgtgctg cgccgtgtgc tgccggcgag cggcagcgtg       120
     ctcgaaatcg cgagcggcac cgggcagcac gtcgttcact tcgcgcaagc gttgccgggc       180
     ctgcactggc agccgagtga tcccgatgcg caggcgcggc gttcgatcgc cgcgtgggtc       240
     gcgcatgcgg gcctcgcgaa cgtcgccggg ccgctggcgt tcgacgtgcg cgacgcgccg       300
     tggccggtcg cggcgctcga cgcgatcgtc tgcatcaaca tgatccatat ctcgccgtgg       360
     gcctgtaccg acgcgctgtt cgcgggcgcg tcgcgcgtgc tgcgtccggg cggcgtgctg       420
     ttcctgtacg gtccgtaccg tcgcgaaggc cggcatacgg cgccgtcgaa cgaagcgttc       480
     gaccggcagt tgcgcagccg cgacccgtcg tggggcgtgc gcgatctcga gaccgtggtc       540
     gcgctcgggc tcgacctcgg cctcgactgc agcgaggtcg tcgagatgcc ggcgaacaac       600
     ctgagcgtcg tgttccggcg cctgccgcac gcggagcaat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page