(data stored in ACNUC1104 zone)

EMBL: CP000959.PE433

CP000959.PE433       Location/Qualifiers
FT   CDS_pept        complement(510495..511409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3622"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: bur:Bcep18194_B2183 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92774"
FT                   /db_xref="GOA:B1K3Q3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q3"
FT                   /protein_id="ACA92774.1"
FT                   /translation="MNDKALPDSSLADADPAALDALQTFVERHPRLLVLTGAGISTDSG
FT                   IPGYRDRNGQWMRSPPIQLQEFLGSDAARRRYWARSMIGWPVVGRARPNGSHVALARLG
FT                   DAGRIERLVTQNVDGLHQRAGSDDVIELHGGINGVTCLECGAHHARATIQTVLEADNPE
FT                   LLGAQAEPAADGDAHLEWAALDTFRVPACPACGGLLKPAVVFFGENVPRERVALASQAL
FT                   DAADALLVVGSSLMVYSGYRFCVWAQAQHKPVAALNLGHTRADPMLTLKVEAHCAPALD
FT                   ALVARLGLGRNSASTSDTTEHAS"
     atgaacgaca aagccttgcc cgattcctcc ctcgccgacg ccgatccggc cgcgctcgat        60
     gcgctgcaga ccttcgtcga gcgtcatccg cgcctgctcg tgctgaccgg cgcgggcatc       120
     agcaccgatt ccggcattcc cggttatcgc gaccgcaacg gccaatggat gcgctcgccg       180
     ccgatccaac tccaggaatt cctcggttcc gatgccgcgc ggcgccgcta ctgggcgcgc       240
     agcatgatcg gctggccggt cgtcggccgc gcgcggccga acgggtcgca tgtcgcgctg       300
     gcgcggctcg gcgacgcagg gcgaatcgag cgcctcgtca cgcagaacgt cgacggcctg       360
     catcagcgcg cgggcagcga cgacgtgatc gaactgcacg gcggcatcaa cggcgtgacc       420
     tgcctcgaat gcggcgcgca tcacgcgcga gcgacgattc agaccgtgct cgaagccgac       480
     aatcccgaac tgctgggcgc gcaggccgag cccgccgcgg acggcgacgc gcatctggaa       540
     tgggccgcgc tcgatacgtt ccgcgttccg gcgtgccccg cgtgcggcgg cttgctgaag       600
     cctgcggtgg tgttcttcgg cgagaacgtg ccgcgcgagc gcgtggcgct ggcgtcgcag       660
     gcgctcgatg cggccgacgc gctgctcgtc gtcggctcgt cgctgatggt gtattccggc       720
     taccgcttct gcgtgtgggc gcaggcgcag cacaagccgg ttgccgcact caatctcggc       780
     catacgcgcg ccgacccgat gctgacgctg aaggtcgagg cgcactgcgc gcccgcgctc       840
     gacgcactcg tggcgcggct ggggctcggg cgcaacagcg ccagcaccag cgacacgacg       900
     gagcatgcat cgtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page